GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-19 10:55:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_016789461             603 bp    mRNA    linear   PLN 11-SEP-2023
DEFINITION  Scedosporium apiospermum uncharacterized protein (SAPIO_CDS7644),
            partial mRNA.
ACCESSION   XM_016789461
VERSION     XM_016789461.1
DBLINK      BioProject: PRJNA319335
            BioSample: SAMN02727168
KEYWORDS    RefSeq.
SOURCE      Scedosporium apiospermum (Pseudallescheria apiosperma)
  ORGANISM  Scedosporium apiospermum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Microascales; Microascaceae;
            Scedosporium.
REFERENCE   1  (bases 1 to 603)
  AUTHORS   Vandeputte,P., Ghamrawi,S., Rechenmann,M., Iltis,A., Giraud,S.,
            Fleury,M., Thornton,C., Delhaes,L., Meyer,W., Papon,N. and
            Bouchara,J.P.
  TITLE     Draft Genome Sequence of the Pathogenic Fungus Scedosporium
            apiospermum
  JOURNAL   Genome Announc 2 (5) (2014)
   PUBMED   25278533
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 603)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 603)
  AUTHORS   Vandeputte,P., Rechenmann,M. and Bouchara,J.-P.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) GEIHP-EA3142, LUNAM Universite d'Angers, 4
            rue Larrey, Angers cedex 9 49933, France
  REMARK    Annotation on contig JOWA01000087.1 updated by submitter
REFERENCE   4  (bases 1 to 603)
  AUTHORS   Vandeputte,P., Rechenmann,M. and Bouchara,J.-P.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2014) GEIHP-EA3142, LUNAM Universite d'Angers, 4
            rue Larrey, Angers cedex 9 49933, France
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_015971811).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..603
                     /organism="Scedosporium apiospermum"
                     /mol_type="mRNA"
                     /strain="IHEM 14462"
                     /isolation_source="sputum"
                     /host="Homo sapiens"
                     /db_xref="taxon:563466"
                     /chromosome="Unknown"
                     /country="France: Tours"
                     /lat_lon="47.346732 N 0.716252 E"
                     /collection_date="1998-03-04"
                     /collected_by="Jean-Philippe Bouchara"
     gene            <1..>603
                     /locus_tag="SAPIO_CDS7644"
                     /db_xref="GeneID:27726716"
     CDS             1..603
                     /locus_tag="SAPIO_CDS7644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016641288.1"
                     /db_xref="GeneID:27726716"
                     /translation="
MLSSPVTISDHPSPAWSNQWLHPSTGNPFTLKFCQSDELSAGDLQACLDLVEETSGEHYKSSSRGWHPGSKRREMREADMRYILVKDESDVVKGFTSLMPCYEEGEPVIYCYEIHLKPELQGTGLGRTLMSFLETIAANVPTVNKVMLTCFLCNTKGLEFYKRIGFEKDEISPEPRKLRFGKVFEPDYVILSKVVGRGNA"
     misc_feature    <226..498
                     /locus_tag="SAPIO_CDS7644"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:395465"
     misc_feature    order(340..348,376..381)
                     /locus_tag="SAPIO_CDS7644"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
ORIGIN      
atgctttcctccccagtcacaatttctgaccatccaagcccagcatggagcaaccaatggttacacccctcgacggggaatccatttactctcaagttttgtcaatccgatgagctcagcgcaggagacctccaggcgtgtcttgatcttgtcgaggaaacctctggagagcactacaagtcttcgtcgaggggatggcatcccggtagtaagaggagagagatgcgagaggccgacatgcggtacatactcgtcaaggacgagagcgacgtcgtaaaagggttcacgtcgttgatgccgtgctatgaagagggtgagccggtgatttactgctatgagattcatctcaaacctgagttgcagggaaccgggctcgggaggacattaatgagtttcctcgagacaattgcggcgaatgtgccgactgttaataaggtcatgctgacctgctttctctgtaacacgaaaggcctcgagttctataagaggatcgggttcgagaaagatgaaatatcccccgagccgaggaaactgaggttcgggaaagtgttcgagccggactatgtcattttgagcaaggtagtcggtcggggcaatgcctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]