2024-04-19 10:55:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_016789461 603 bp mRNA linear PLN 11-SEP-2023 DEFINITION Scedosporium apiospermum uncharacterized protein (SAPIO_CDS7644), partial mRNA. ACCESSION XM_016789461 VERSION XM_016789461.1 DBLINK BioProject: PRJNA319335 BioSample: SAMN02727168 KEYWORDS RefSeq. SOURCE Scedosporium apiospermum (Pseudallescheria apiosperma) ORGANISM Scedosporium apiospermum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Microascales; Microascaceae; Scedosporium. REFERENCE 1 (bases 1 to 603) AUTHORS Vandeputte,P., Ghamrawi,S., Rechenmann,M., Iltis,A., Giraud,S., Fleury,M., Thornton,C., Delhaes,L., Meyer,W., Papon,N. and Bouchara,J.P. TITLE Draft Genome Sequence of the Pathogenic Fungus Scedosporium apiospermum JOURNAL Genome Announc 2 (5) (2014) PUBMED 25278533 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 603) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (11-SEP-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 603) AUTHORS Vandeputte,P., Rechenmann,M. and Bouchara,J.-P. TITLE Direct Submission JOURNAL Submitted (30-MAR-2018) GEIHP-EA3142, LUNAM Universite d'Angers, 4 rue Larrey, Angers cedex 9 49933, France REMARK Annotation on contig JOWA01000087.1 updated by submitter REFERENCE 4 (bases 1 to 603) AUTHORS Vandeputte,P., Rechenmann,M. and Bouchara,J.-P. TITLE Direct Submission JOURNAL Submitted (23-JUN-2014) GEIHP-EA3142, LUNAM Universite d'Angers, 4 rue Larrey, Angers cedex 9 49933, France COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_015971811). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..603 /organism="Scedosporium apiospermum" /mol_type="mRNA" /strain="IHEM 14462" /isolation_source="sputum" /host="Homo sapiens" /db_xref="taxon:563466" /chromosome="Unknown" /country="France: Tours" /lat_lon="47.346732 N 0.716252 E" /collection_date="1998-03-04" /collected_by="Jean-Philippe Bouchara" gene <1..>603 /locus_tag="SAPIO_CDS7644" /db_xref="GeneID:27726716" CDS 1..603 /locus_tag="SAPIO_CDS7644" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016641288.1" /db_xref="GeneID:27726716" /translation="
MLSSPVTISDHPSPAWSNQWLHPSTGNPFTLKFCQSDELSAGDLQACLDLVEETSGEHYKSSSRGWHPGSKRREMREADMRYILVKDESDVVKGFTSLMPCYEEGEPVIYCYEIHLKPELQGTGLGRTLMSFLETIAANVPTVNKVMLTCFLCNTKGLEFYKRIGFEKDEISPEPRKLRFGKVFEPDYVILSKVVGRGNA"
misc_feature <226..498 /locus_tag="SAPIO_CDS7644" /note="Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583" /db_xref="CDD:395465" misc_feature order(340..348,376..381) /locus_tag="SAPIO_CDS7644" /note="Coenzyme A binding pocket [chemical binding]; other site" /db_xref="CDD:173926" ORIGIN
atgctttcctccccagtcacaatttctgaccatccaagcccagcatggagcaaccaatggttacacccctcgacggggaatccatttactctcaagttttgtcaatccgatgagctcagcgcaggagacctccaggcgtgtcttgatcttgtcgaggaaacctctggagagcactacaagtcttcgtcgaggggatggcatcccggtagtaagaggagagagatgcgagaggccgacatgcggtacatactcgtcaaggacgagagcgacgtcgtaaaagggttcacgtcgttgatgccgtgctatgaagagggtgagccggtgatttactgctatgagattcatctcaaacctgagttgcagggaaccgggctcgggaggacattaatgagtttcctcgagacaattgcggcgaatgtgccgactgttaataaggtcatgctgacctgctttctctgtaacacgaaaggcctcgagttctataagaggatcgggttcgagaaagatgaaatatcccccgagccgaggaaactgaggttcgggaaagtgttcgagccggactatgtcattttgagcaaggtagtcggtcggggcaatgcctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]