GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-28 18:00:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_016292297             646 bp    mRNA    linear   VRT 19-APR-2016
DEFINITION  PREDICTED: Sinocyclocheilus grahami dachshund homolog 1-like
            (LOC107600400), mRNA.
ACCESSION   XM_016292297
VERSION     XM_016292297.1
DBLINK      BioProject: PRJNA316320
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Sinocyclocheilus grahami
  ORGANISM  Sinocyclocheilus grahami
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Cyprinidae; Cyprininae; Sinocyclocheilus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_015505462.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Sinocyclocheilus grahami Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 22% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..646
                     /organism="Sinocyclocheilus grahami"
                     /mol_type="mRNA"
                     /isolate="Dianchi"
                     /db_xref="taxon:75366"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /country="China: Lake Dianchi, Yunnan"
                     /collection_date="2012-08-15"
                     /note="surface-dwelling"
     gene            1..646
                     /gene="LOC107600400"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 75% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:107600400"
     CDS             8..646
                     /gene="LOC107600400"
                     /codon_start=1
                     /product="dachshund homolog 1-like"
                     /protein_id="XP_016147783.1"
                     /db_xref="GeneID:107600400"
                     /translation="
MCTPTARDSYERLSFAGQTLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMELFRERELRETLEKQLAVEQKNRAIIQKRLKKEKKAKRKLQEALEYESKRREQAEQSLKQTSTTESLRSLNDSLTQEIETDRSSGRTDAERTIQDSLTQEIETDRSSGRTDAERTIQACCSCIQPAIWAADPTVQEEGQDQ"
ORIGIN      
aacccccatgtgcacgccaacagcaagagacagttatgagaggctctcgtttgcgggtcagacattaccgccaggattcccctcacccttcctcttccctgatggcctgtcatctatagagacccttctgactaacatccagggtttgctgaaggtggcaattgataacgctcgtgctcaggagaaacaagtgcagctggagaagacggagctgaagatggagctgtttagagagcgagagctcagagaaaccctagagaaacaactggctgttgagcagaagaacagagcgatcattcagaagcgattgaagaaagaaaagaaagcaaagaggaaattgcaggaggcgctggagtatgagtcaaaacggcgagagcaggcagagcaatccctgaaacagacctcaaccacagaaagtctcagatcactcaatgactcgttgacccaggagatagagactgaccgcagcagtggcagaacagatgctgagaggacaatacaagactcgttgacccaggagatagagactgaccgcagcagtggcagaacagatgctgagaggacaatacaagcctgctgttcatgcatacagcctgccatctgggctgcagatcctacagttcaagaggaaggtcaagatcagtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]