2024-03-28 18:00:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_016292297 646 bp mRNA linear VRT 19-APR-2016 DEFINITION PREDICTED: Sinocyclocheilus grahami dachshund homolog 1-like (LOC107600400), mRNA. ACCESSION XM_016292297 VERSION XM_016292297.1 DBLINK BioProject: PRJNA316320 KEYWORDS RefSeq; includes ab initio. SOURCE Sinocyclocheilus grahami ORGANISM Sinocyclocheilus grahami Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Cyprininae; Sinocyclocheilus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_015505462.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Sinocyclocheilus grahami Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 22% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..646 /organism="Sinocyclocheilus grahami" /mol_type="mRNA" /isolate="Dianchi" /db_xref="taxon:75366" /chromosome="Unknown" /sex="female" /tissue_type="muscle" /dev_stage="adult" /country="China: Lake Dianchi, Yunnan" /collection_date="2012-08-15" /note="surface-dwelling" gene 1..646 /gene="LOC107600400" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 75% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:107600400" CDS 8..646 /gene="LOC107600400" /codon_start=1 /product="dachshund homolog 1-like" /protein_id="XP_016147783.1" /db_xref="GeneID:107600400" /translation="
MCTPTARDSYERLSFAGQTLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMELFRERELRETLEKQLAVEQKNRAIIQKRLKKEKKAKRKLQEALEYESKRREQAEQSLKQTSTTESLRSLNDSLTQEIETDRSSGRTDAERTIQDSLTQEIETDRSSGRTDAERTIQACCSCIQPAIWAADPTVQEEGQDQ"
ORIGIN
aacccccatgtgcacgccaacagcaagagacagttatgagaggctctcgtttgcgggtcagacattaccgccaggattcccctcacccttcctcttccctgatggcctgtcatctatagagacccttctgactaacatccagggtttgctgaaggtggcaattgataacgctcgtgctcaggagaaacaagtgcagctggagaagacggagctgaagatggagctgtttagagagcgagagctcagagaaaccctagagaaacaactggctgttgagcagaagaacagagcgatcattcagaagcgattgaagaaagaaaagaaagcaaagaggaaattgcaggaggcgctggagtatgagtcaaaacggcgagagcaggcagagcaatccctgaaacagacctcaaccacagaaagtctcagatcactcaatgactcgttgacccaggagatagagactgaccgcagcagtggcagaacagatgctgagaggacaatacaagactcgttgacccaggagatagagactgaccgcagcagtggcagaacagatgctgagaggacaatacaagcctgctgttcatgcatacagcctgccatctgggctgcagatcctacagttcaagaggaaggtcaagatcagtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]