GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 04:41:45, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_015968871             660 bp    mRNA    linear   VRT 18-MAR-2016
DEFINITION  PREDICTED: Nothobranchius furzeri mitochondrial ribosomal protein
            L49 (mrpl49), mRNA.
ACCESSION   XM_015968871
VERSION     XM_015968871.1
DBLINK      BioProject: PRJNA314891
KEYWORDS    RefSeq.
SOURCE      Nothobranchius furzeri (turquoise killifish)
  ORGANISM  Nothobranchius furzeri
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes;
            Nothobranchiidae; Nothobranchius.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_015443588.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Nothobranchius furzeri Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..660
                     /organism="Nothobranchius furzeri"
                     /mol_type="mRNA"
                     /strain="GRZ"
                     /db_xref="taxon:105023"
                     /chromosome="sgr15"
                     /sex="female"
                     /tissue_type="trunk part"
     gene            1..660
                     /gene="mrpl49"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 ESTs, 7 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:107391536"
     CDS             53..568
                     /gene="mrpl49"
                     /codon_start=1
                     /product="39S ribosomal protein L49, mitochondrial"
                     /protein_id="XP_015824357.1"
                     /db_xref="GeneID:107391536"
                     /translation="
MSPCFGVRAAVLRGALRGPVVLHSRTQSGHAAAAGPGLASHPAVVESTEEYAFVERLIPPSRVPAPPKHAGAAPSGWIPPAESPPDLPYMIRRSRMHNIPVYTDLTHGNRKMTLVRKVEGDIWALEKHVKEYLKEVTGKELPTQVNEVTMTLKVKGHYDLELKEWLASRGF"
     misc_feature    311..565
                     /gene="mrpl49"
                     /note="Mitochondrial large subunit ribosomal protein
                     (Img2); Region: Img2; pfam05046"
                     /db_xref="CDD:398637"
ORIGIN      
tccggttttacataaactctgaggaagaccttttccggttcaaatcttcaaaatgtcgccctgcttcggcgttcgggccgcggtgctccgcggggctctacgcggacctgttgtcctccacagccggacacaaagcggccatgccgccgccgccgggcccgggctggcgtcccacccggccgtggtggagtccacggaggagtacgcgttcgtggagcggctcattcctccatctcgagttcccgctccgcctaaacacgccggagccgccccgtccggatggatccctccggccgagtctccgccggatctaccgtacatgatccgccgctcccgcatgcacaacatcccggtttacacggacctgactcacggtaaccgcaagatgacgctggtgcggaaggtggagggggacatatgggctctggagaagcacgtgaaggagtacctgaaggaggtgacggggaaagagctgcccacgcaggtcaacgaggtcaccatgacgctaaaggtcaaaggtcactatgacctggagctgaaggagtggctggccagcagaggcttctgaccgtggagctgcatcagcttttcttgtgtagagacggtctgataatgttcatgtcggctgttgcctcattaaacatggctgctgtgacccag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]