2024-04-25 19:12:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_015847058 210 bp mRNA linear PLN 11-OCT-2017 DEFINITION Paracoccidioides lutzii Pb01 hypothetical protein (PAAG_11403), partial mRNA. ACCESSION XM_015847058 VERSION XM_015847058.1 DBLINK BioProject: PRJNA48325 BioSample: SAMN02953719 KEYWORDS RefSeq. SOURCE Paracoccidioides lutzii Pb01 ORGANISM Paracoccidioides lutzii Pb01 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Paracoccidioides. REFERENCE 1 (bases 1 to 210) AUTHORS Desjardins,C.A., Champion,M.D., Holder,J.W., Muszewska,A., Goldberg,J., Bailao,A.M., Brigido,M.M., Ferreira,M.E., Garcia,A.M., Grynberg,M., Gujja,S., Heiman,D.I., Henn,M.R., Kodira,C.D., Leon-Narvaez,H., Longo,L.V., Ma,L.J., Malavazi,I., Matsuo,A.L., Morais,F.V., Pereira,M., Rodriguez-Brito,S., Sakthikumar,S., Salem-Izacc,S.M., Sykes,S.M., Teixeira,M.M., Vallejo,M.C., Walter,M.E., Yandava,C., Young,S., Zeng,Q., Zucker,J., Felipe,M.S., Goldman,G.H., Haas,B.J., McEwen,J.G., Nino-Vega,G., Puccia,R., San-Blas,G., Soares,C.M., Birren,B.W. and Cuomo,C.A. TITLE Comparative genomic analysis of human fungal pathogens causing paracoccidioidomycosis JOURNAL PLoS Genet. 7 (10), E1002345 (2011) PUBMED 22046142 REFERENCE 2 (bases 1 to 210) AUTHORS Cuomo,C., Clay,O., McEwen,J., Desjardins,C., Abeel,T., Young,S., Zeng,Q., Gargeya,S., Abouelleil,A., Alvarado,L., Chapman,S.B., Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M., Howarth,C., Imamovic,A., Larimer,J., Murphy,C., Naylor,J., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE The Genome Sequence of Paracoccidioides sp. 'lutzii' Pb01 JOURNAL Unpublished REFERENCE 3 (bases 1 to 210) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (11-OCT-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 4 (bases 1 to 210) AUTHORS Cuomo,C., Clay,O., McEwen,J., Desjardins,C., Abeel,T., Young,S., Zeng,Q., Gargeya,S., Abouelleil,A., Alvarado,L., Chapman,S.B., Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M., Howarth,C., Imamovic,A., Larimer,J., Murphy,C., Naylor,J., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE Direct Submission JOURNAL Submitted (20-AUG-2014) Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA 02142, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_015440950). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..210 /organism="Paracoccidioides lutzii Pb01" /mol_type="mRNA" /strain="Pb01" /type_material="culture from holotype of Paracoccidioides lutzii" /db_xref="taxon:502779" /chromosome="Unknown" gene <1..>210 /locus_tag="PAAG_11403" /db_xref="GeneID:26970417" CDS 1..210 /locus_tag="PAAG_11403" /codon_start=1 /product="hypothetical protein" /protein_id="XP_015703320.1" /db_xref="GeneID:26970417" /translation="
MEASLVVLHQEFGSAIQELRSENQQLQADCQSLRAECQSLHTALNSSRSQSRPKPSLPDLERIPGSLYC"
misc_feature <46..120 /locus_tag="PAAG_11403" /note="Basic leucine zipper (bZIP) domain of bZIP transcription factors: a DNA-binding and dimerization domain; Region: bZIP; cl21462" /db_xref="CDD:451253" ORIGIN
atggaagcttctcttgttgtccttcaccaggaatttgggagtgctattcaggagcttcgcagtgagaatcaacagctccaggctgattgccaatctttacgggctgaatgtcaatcattacatacagctctgaacagctcccgatcccaatcccgtccgaagccttcactgccagaccttgaacgaatccctggcagcctatattgctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]