GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 19:12:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_015847058             210 bp    mRNA    linear   PLN 11-OCT-2017
DEFINITION  Paracoccidioides lutzii Pb01 hypothetical protein (PAAG_11403),
            partial mRNA.
ACCESSION   XM_015847058
VERSION     XM_015847058.1
DBLINK      BioProject: PRJNA48325
            BioSample: SAMN02953719
KEYWORDS    RefSeq.
SOURCE      Paracoccidioides lutzii Pb01
  ORGANISM  Paracoccidioides lutzii Pb01
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Onygenales; Onygenales incertae
            sedis; Paracoccidioides.
REFERENCE   1  (bases 1 to 210)
  AUTHORS   Desjardins,C.A., Champion,M.D., Holder,J.W., Muszewska,A.,
            Goldberg,J., Bailao,A.M., Brigido,M.M., Ferreira,M.E., Garcia,A.M.,
            Grynberg,M., Gujja,S., Heiman,D.I., Henn,M.R., Kodira,C.D.,
            Leon-Narvaez,H., Longo,L.V., Ma,L.J., Malavazi,I., Matsuo,A.L.,
            Morais,F.V., Pereira,M., Rodriguez-Brito,S., Sakthikumar,S.,
            Salem-Izacc,S.M., Sykes,S.M., Teixeira,M.M., Vallejo,M.C.,
            Walter,M.E., Yandava,C., Young,S., Zeng,Q., Zucker,J., Felipe,M.S.,
            Goldman,G.H., Haas,B.J., McEwen,J.G., Nino-Vega,G., Puccia,R.,
            San-Blas,G., Soares,C.M., Birren,B.W. and Cuomo,C.A.
  TITLE     Comparative genomic analysis of human fungal pathogens causing
            paracoccidioidomycosis
  JOURNAL   PLoS Genet. 7 (10), E1002345 (2011)
   PUBMED   22046142
REFERENCE   2  (bases 1 to 210)
  AUTHORS   Cuomo,C., Clay,O., McEwen,J., Desjardins,C., Abeel,T., Young,S.,
            Zeng,Q., Gargeya,S., Abouelleil,A., Alvarado,L., Chapman,S.B.,
            Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M.,
            Howarth,C., Imamovic,A., Larimer,J., Murphy,C., Naylor,J.,
            Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T.,
            Sykes,S., Wortman,J., Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genomics Platform
  TITLE     The Genome Sequence of Paracoccidioides sp. 'lutzii' Pb01
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 210)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 210)
  AUTHORS   Cuomo,C., Clay,O., McEwen,J., Desjardins,C., Abeel,T., Young,S.,
            Zeng,Q., Gargeya,S., Abouelleil,A., Alvarado,L., Chapman,S.B.,
            Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M.,
            Howarth,C., Imamovic,A., Larimer,J., Murphy,C., Naylor,J.,
            Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T.,
            Sykes,S., Wortman,J., Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genomics Platform
  TITLE     Direct Submission
  JOURNAL   Submitted (20-AUG-2014) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_015440950).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..210
                     /organism="Paracoccidioides lutzii Pb01"
                     /mol_type="mRNA"
                     /strain="Pb01"
                     /type_material="culture from holotype of Paracoccidioides
                     lutzii"
                     /db_xref="taxon:502779"
                     /chromosome="Unknown"
     gene            <1..>210
                     /locus_tag="PAAG_11403"
                     /db_xref="GeneID:26970417"
     CDS             1..210
                     /locus_tag="PAAG_11403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_015703320.1"
                     /db_xref="GeneID:26970417"
                     /translation="
MEASLVVLHQEFGSAIQELRSENQQLQADCQSLRAECQSLHTALNSSRSQSRPKPSLPDLERIPGSLYC"
     misc_feature    <46..120
                     /locus_tag="PAAG_11403"
                     /note="Basic leucine zipper (bZIP) domain of bZIP
                     transcription factors: a DNA-binding and dimerization
                     domain; Region: bZIP; cl21462"
                     /db_xref="CDD:451253"
ORIGIN      
atggaagcttctcttgttgtccttcaccaggaatttgggagtgctattcaggagcttcgcagtgagaatcaacagctccaggctgattgccaatctttacgggctgaatgtcaatcattacatacagctctgaacagctcccgatcccaatcccgtccgaagccttcactgccagaccttgaacgaatccctggcagcctatattgctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]