GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-19 18:53:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_015396831            1607 bp    mRNA    linear   VRT 14-JAN-2016
DEFINITION  PREDICTED: Cyprinodon variegatus protein argonaute-3-like
            (LOC107098936), mRNA.
ACCESSION   XM_015396831
VERSION     XM_015396831.1
DBLINK      BioProject: PRJNA308224
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Cyprinodon variegatus (sheepshead minnow)
  ORGANISM  Cyprinodon variegatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes;
            Cyprinodontidae; Cyprinodon.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_015151276.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Cyprinodon variegatus Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1607
                     /organism="Cyprinodon variegatus"
                     /mol_type="mRNA"
                     /isolate="N-32"
                     /db_xref="taxon:28743"
                     /chromosome="Unknown"
                     /sex="female"
                     /country="USA: Navarre, FL"
                     /collection_date="17-Sep-2010"
     gene            1..1607
                     /gene="LOC107098936"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 40 Proteins, and 99% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 29 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:107098936"
     CDS             276..1607
                     /gene="LOC107098936"
                     /codon_start=1
                     /product="protein argonaute-3-like"
                     /protein_id="XP_015252317.1"
                     /db_xref="GeneID:107098936"
                     /translation="
MEIGTTGAQTLFTLPRRPGYGSIGKPIKLLANCFQVEIPKIDVYLYEVDIKPEKCPRRVNREVVDSMVQHFKVTIFGDRMPVYDGKRSLYTASPLPVATGGVDLDVTLPGEGGKDRPFKVSIRFVSLVSWHLLHEVLTGRGVPEPLDLDKPLSTNPVHAVDVVLRHLPSMKYTPVGRSFFSSPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNMDEQPRSLPDSHRVKFTKEIKGLKVEVTHCGSMRRKYRVCNVTRRPASLQTFPLQLENGQTVERTVAQYFREKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVPGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYESDPFVQEFQFRVRDEMAQVTGRVLPAPMLQYGGRVSSEPFMVPFLLNHAPHTPALG"
     misc_feature    324..>1532
                     /gene="LOC107098936"
                     /note="protein argonaute; Provisional; Region: PLN03202"
                     /db_xref="CDD:215631"
ORIGIN      
ctgcgccatctttccggttggtttgattagaccggttttatcggaggaggacaccgggttcccgaactcctaacgcccgtctgaggaagaggaacgccggcttgtcacctccactccacggaacatcgagttcggcctgtgcagggaaggcaaagaaccgggccaggaccgtgtggtaccgctgcgagccgaaagccagggagggagggggggtgggccacccggatccacacggagtaacagtgagccgggtcatccggaccgagacctcatgaatggaaatcggaacaacaggagcccaaaccttgtttacgttgccacggcgacccggatatggctccatcggaaagcccatcaagctcctggccaactgcttccaggtggaaatccctaagatcgacgtttacctgtacgaggtggacatcaagccggagaaatgtccccgacgagtcaacagggaggtggtggactccatggtgcagcacttcaaggtgaccatctttggcgaccggatgccggtctacgacgggaagagaagcctctacaccgccagtccacttcctgtcgccacaggaggggtggatctggacgtcaccctgccgggggaaggtgggaaggaccgcccctttaaggtctccatccgattcgtctccctcgtcagttggcatctgctgcacgaagtcctgacgggacgtggcgttccagaaccgctggacctggacaagccgctcagcaccaacccggttcacgcggtggacgtggtcctgcgacacctgccctccatgaagtacaccccggtgggacggtccttcttctcctcccctgagggctacgaccacccgctggggggagggcgggaggtttggttcggtttccatcagtcggtgaggcccgccatgtggaagatgatgctgaacatcgatgtttcagccacagcgttttacaaagcccagccggtcatccagttcatgtgtgaggtgctggacatccacaacatggacgagcagccgcgctcgctgccggactcccacagggtcaagttcaccaaagagatcaaaggtcttaaagtggaagtcacccactgtggaagcatgcgcaggaagtacagagtgtgtaacgtcacccggcggcctgccagcctgcagacgtttccactgcagctggagaacggccagacggtggagcgcactgtggcgcagtacttcagggagaagtacagtctgcagctgaagtacccccacctgccctgcctgcaggtgggccaggagcagaagcacacctacctgcctctggaggtgtgtaacatcgtccccggtcagcgctgcattaagaagctaacagacaaccagacgtccaccatgatcaaagccacggcgcggtctgctccagacagacaggaggagatcagccgcctggtgaggagcgccaactacgagtcggacccgtttgtgcaggagttccagttcagagtgcgggatgagatggctcaggtgacgggccgcgtcctgccggcccccatgctgcagtatggcggcagggtgagctctgaaccctttatggtacctttccttttaaatcacgctccacacacgcccgctttaggctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]