2024-04-19 18:53:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_015396831 1607 bp mRNA linear VRT 14-JAN-2016 DEFINITION PREDICTED: Cyprinodon variegatus protein argonaute-3-like (LOC107098936), mRNA. ACCESSION XM_015396831 VERSION XM_015396831.1 DBLINK BioProject: PRJNA308224 KEYWORDS RefSeq; includes ab initio. SOURCE Cyprinodon variegatus (sheepshead minnow) ORGANISM Cyprinodon variegatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes; Cyprinodontidae; Cyprinodon. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_015151276.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Cyprinodon variegatus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1607 /organism="Cyprinodon variegatus" /mol_type="mRNA" /isolate="N-32" /db_xref="taxon:28743" /chromosome="Unknown" /sex="female" /country="USA: Navarre, FL" /collection_date="17-Sep-2010" gene 1..1607 /gene="LOC107098936" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 40 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns" /db_xref="GeneID:107098936" CDS 276..1607 /gene="LOC107098936" /codon_start=1 /product="protein argonaute-3-like" /protein_id="XP_015252317.1" /db_xref="GeneID:107098936" /translation="
MEIGTTGAQTLFTLPRRPGYGSIGKPIKLLANCFQVEIPKIDVYLYEVDIKPEKCPRRVNREVVDSMVQHFKVTIFGDRMPVYDGKRSLYTASPLPVATGGVDLDVTLPGEGGKDRPFKVSIRFVSLVSWHLLHEVLTGRGVPEPLDLDKPLSTNPVHAVDVVLRHLPSMKYTPVGRSFFSSPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNMDEQPRSLPDSHRVKFTKEIKGLKVEVTHCGSMRRKYRVCNVTRRPASLQTFPLQLENGQTVERTVAQYFREKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVPGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYESDPFVQEFQFRVRDEMAQVTGRVLPAPMLQYGGRVSSEPFMVPFLLNHAPHTPALG"
misc_feature 324..>1532 /gene="LOC107098936" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" ORIGIN
ctgcgccatctttccggttggtttgattagaccggttttatcggaggaggacaccgggttcccgaactcctaacgcccgtctgaggaagaggaacgccggcttgtcacctccactccacggaacatcgagttcggcctgtgcagggaaggcaaagaaccgggccaggaccgtgtggtaccgctgcgagccgaaagccagggagggagggggggtgggccacccggatccacacggagtaacagtgagccgggtcatccggaccgagacctcatgaatggaaatcggaacaacaggagcccaaaccttgtttacgttgccacggcgacccggatatggctccatcggaaagcccatcaagctcctggccaactgcttccaggtggaaatccctaagatcgacgtttacctgtacgaggtggacatcaagccggagaaatgtccccgacgagtcaacagggaggtggtggactccatggtgcagcacttcaaggtgaccatctttggcgaccggatgccggtctacgacgggaagagaagcctctacaccgccagtccacttcctgtcgccacaggaggggtggatctggacgtcaccctgccgggggaaggtgggaaggaccgcccctttaaggtctccatccgattcgtctccctcgtcagttggcatctgctgcacgaagtcctgacgggacgtggcgttccagaaccgctggacctggacaagccgctcagcaccaacccggttcacgcggtggacgtggtcctgcgacacctgccctccatgaagtacaccccggtgggacggtccttcttctcctcccctgagggctacgaccacccgctggggggagggcgggaggtttggttcggtttccatcagtcggtgaggcccgccatgtggaagatgatgctgaacatcgatgtttcagccacagcgttttacaaagcccagccggtcatccagttcatgtgtgaggtgctggacatccacaacatggacgagcagccgcgctcgctgccggactcccacagggtcaagttcaccaaagagatcaaaggtcttaaagtggaagtcacccactgtggaagcatgcgcaggaagtacagagtgtgtaacgtcacccggcggcctgccagcctgcagacgtttccactgcagctggagaacggccagacggtggagcgcactgtggcgcagtacttcagggagaagtacagtctgcagctgaagtacccccacctgccctgcctgcaggtgggccaggagcagaagcacacctacctgcctctggaggtgtgtaacatcgtccccggtcagcgctgcattaagaagctaacagacaaccagacgtccaccatgatcaaagccacggcgcggtctgctccagacagacaggaggagatcagccgcctggtgaggagcgccaactacgagtcggacccgtttgtgcaggagttccagttcagagtgcgggatgagatggctcaggtgacgggccgcgtcctgccggcccccatgctgcagtatggcggcagggtgagctctgaaccctttatggtacctttccttttaaatcacgctccacacacgcccgctttaggctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]