LOCUS       XM_015312875             420 bp    mRNA    linear   PLN 04-APR-2025
DEFINITION  PREDICTED: Solanum tuberosum F-box/LRR-repeat protein
            At3g48880-like (LOC107062341), mRNA.
ACCESSION   XM_015312875
VERSION     XM_015312875.1
DBLINK      BioProject: PRJNA225997
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Solanum tuberosum (potato)
  ORGANISM  Solanum tuberosum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006239144.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000226075.1-RS_2025_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/03/2025
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..420
                     /organism="Solanum tuberosum"
                     /mol_type="mRNA"
                     /cultivar="DM 1-3 516 R44"
                     /db_xref="taxon:4113"
                     /chromosome="Unknown"
     gene            1..420
                     /gene="LOC107062341"
                     /note="F-box/LRR-repeat protein At3g48880-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:107062341"
     CDS             1..420
                     /gene="LOC107062341"
                     /codon_start=1
                     /product="F-box/LRR-repeat protein At3g48880-like"
                     /protein_id="XP_015168361.1"
                     /db_xref="GeneID:107062341"
                     /translation="

MSFPKQEEIEVVVMEEGTSPVRIWEDLNIDMLVKIFQSFDLFQLISVIPQVCHAWQSACSDQHLWKTLDLSIMKSNFIRVSIPPYIYVDTPSREKLNRILKICLILSHGNKLTLIFHYNLYVDNNQLTYSAKRYSPNKL"

     misc_feature    70..210
                     /gene="LOC107062341"
                     /note="F-box domain superfamily; Region: F-box_SF;
                     cl45894"
                     /db_xref="CDD:459239"
     misc_feature    order(79..84,88..96,103..108,115..117,151..159,163..165,
                     172..174)
                     /gene="LOC107062341"
                     /note="F-box motif; other site"
                     /db_xref="CDD:438852"
     misc_feature    order(79..81,91..93,100..105,112..117,127..129,133..138,
                     151..159,163..165)
                     /gene="LOC107062341"
                     /note="Skp1 binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:438852"
ORIGIN      

atgtcgtttccaaaacaagaagagattgaagttgttgtgatggaagaaggaacttctcctgtaaggatatgggaggaccttaatattgatatgctggtgaagatattccaatcctttgaccttttccagttgatctctgtcattcctcaagtttgtcatgcatggcaatcggcttgttctgaccaacatctttggaaaacgctggacttgtcaataatgaagtcaaatttcatcagagtttcaataccgccgtatatatatgttgacactccatctcgtgaaaaattgaaccgcatcctaaagatttgcttgatccttagtcatggaaacaaactgacattgatcttccattacaatttgtatgttgacaataatcagttgacttattctgccaagaggtattctccgaataaactttaa

//