2025-07-03 11:25:53, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_015312875 420 bp mRNA linear PLN 05-JAN-2016 DEFINITION PREDICTED: Solanum tuberosum F-box/LRR-repeat protein At3g48880-like (LOC107062341), mRNA. ACCESSION XM_015312875 VERSION XM_015312875.1 DBLINK BioProject: PRJNA225997 KEYWORDS RefSeq; includes ab initio. SOURCE Solanum tuberosum (potato) ORGANISM Solanum tuberosum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006239144.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Solanum tuberosum Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..420 /organism="Solanum tuberosum" /mol_type="mRNA" /cultivar="DM 1-3 516 R44" /db_xref="taxon:4113" /chromosome="Unknown" gene 1..420 /gene="LOC107062341" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:107062341" CDS 1..420 /gene="LOC107062341" /codon_start=1 /product="F-box/LRR-repeat protein At3g48880-like" /protein_id="XP_015168361.1" /db_xref="GeneID:107062341" /translation="
MSFPKQEEIEVVVMEEGTSPVRIWEDLNIDMLVKIFQSFDLFQLISVIPQVCHAWQSACSDQHLWKTLDLSIMKSNFIRVSIPPYIYVDTPSREKLNRILKICLILSHGNKLTLIFHYNLYVDNNQLTYSAKRYSPNKL"
misc_feature 70..210 /gene="LOC107062341" /note="F-box domain superfamily; Region: F-box_SF; cl45894" /db_xref="CDD:459239" misc_feature order(79..84,88..96,103..108,115..117,151..159,163..165, 172..174) /gene="LOC107062341" /note="F-box motif; other site" /db_xref="CDD:438852" misc_feature order(79..81,91..93,100..105,112..117,127..129,133..138, 151..159,163..165) /gene="LOC107062341" /note="Skp1 binding site [polypeptide binding]; other site" /db_xref="CDD:438852" ORIGIN
atgtcgtttccaaaacaagaagagattgaagttgttgtgatggaagaaggaacttctcctgtaaggatatgggaggaccttaatattgatatgctggtgaagatattccaatcctttgaccttttccagttgatctctgtcattcctcaagtttgtcatgcatggcaatcggcttgttctgaccaacatctttggaaaacgctggacttgtcaataatgaagtcaaatttcatcagagtttcaataccgccgtatatatatgttgacactccatctcgtgaaaaattgaaccgcatcctaaagatttgcttgatccttagtcatggaaacaaactgacattgatcttccattacaatttgtatgttgacaataatcagttgacttattctgccaagaggtattctccgaataaactttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]