GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:10:51, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       XM_015312875             420 bp    mRNA    linear   PLN 05-JAN-2016
DEFINITION  PREDICTED: Solanum tuberosum F-box/LRR-repeat protein
            At3g48880-like (LOC107062341), mRNA.
ACCESSION   XM_015312875
VERSION     XM_015312875.1
DBLINK      BioProject: PRJNA225997
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Solanum tuberosum (potato)
  ORGANISM  Solanum tuberosum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006239144.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Solanum tuberosum Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..420
                     /organism="Solanum tuberosum"
                     /mol_type="mRNA"
                     /cultivar="DM 1-3 516 R44"
                     /db_xref="taxon:4113"
                     /chromosome="Unknown"
     gene            1..420
                     /gene="LOC107062341"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 Proteins"
                     /db_xref="GeneID:107062341"
     CDS             1..420
                     /gene="LOC107062341"
                     /codon_start=1
                     /product="F-box/LRR-repeat protein At3g48880-like"
                     /protein_id="XP_015168361.1"
                     /db_xref="GeneID:107062341"
                     /translation="
MSFPKQEEIEVVVMEEGTSPVRIWEDLNIDMLVKIFQSFDLFQLISVIPQVCHAWQSACSDQHLWKTLDLSIMKSNFIRVSIPPYIYVDTPSREKLNRILKICLILSHGNKLTLIFHYNLYVDNNQLTYSAKRYSPNKL"
     misc_feature    70..213
                     /gene="LOC107062341"
                     /note="F-box-like; Region: F-box-like; pfam12937"
                     /db_xref="CDD:289689"
ORIGIN      
atgtcgtttccaaaacaagaagagattgaagttgttgtgatggaagaaggaacttctcctgtaaggatatgggaggaccttaatattgatatgctggtgaagatattccaatcctttgaccttttccagttgatctctgtcattcctcaagtttgtcatgcatggcaatcggcttgttctgaccaacatctttggaaaacgctggacttgtcaataatgaagtcaaatttcatcagagtttcaataccgccgtatatatatgttgacactccatctcgtgaaaaattgaaccgcatcctaaagatttgcttgatccttagtcatggaaacaaactgacattgatcttccattacaatttgtatgttgacaataatcagttgacttattctgccaagaggtattctccgaataaactttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]