GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-02 18:09:50, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_014688973             609 bp    mRNA    linear   PLN 26-JUN-2024
DEFINITION  Metarhizium brunneum uncharacterized protein (G6M90_00g058850),
            partial mRNA.
ACCESSION   XM_014688973
VERSION     XM_014688973.1
DBLINK      BioProject: PRJNA1128270
            BioSample: SAMN15394350
KEYWORDS    RefSeq.
SOURCE      Metarhizium brunneum
  ORGANISM  Metarhizium brunneum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae;
            Metarhizium.
REFERENCE   1  (bases 1 to 609)
  AUTHORS   Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M.
  TITLE     Telomere length de novo assembly of all 7 chromosomes of the
            fungus, Metarhizium brunneum, using a novel assembly pipeline
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 609)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 609)
  AUTHORS   Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-2020) Biocontrol and Natural Products Group
            (BANP), Biological Sciences, Swansea University, Singleton Park
            Campus, Swansea SA28PP, United Kingdom
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_089424).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..609
                     /organism="Metarhizium brunneum"
                     /mol_type="mRNA"
                     /strain="4556"
                     /host="Boophilus sp. [Acari: Ixodidae]"
                     /db_xref="taxon:500148"
                     /chromosome="3"
                     /geo_loc_name="USA: Florida"
                     /collection_date="29-Sep-1993"
     gene            <1..>609
                     /locus_tag="G6M90_00g058850"
                     /old_locus_tag="MBR_05601"
                     /db_xref="GeneID:26242871"
     CDS             1..609
                     /locus_tag="G6M90_00g058850"
                     /old_locus_tag="MBR_05601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_014544459.1"
                     /db_xref="GeneID:26242871"
                     /db_xref="GO:0005783"
                     /db_xref="GO:0006886,GO"
                     /db_xref="GO:0016021,GO"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="PFAM:PF05529"
                     /translation="
MTLYYSLVFFLLVLEMVLFMLLLIPLPHTAKRKVFTFISENPIISKVMYWLKITFVFILILFIDSVNRVYRVQLEVVAAGEQASKGAAILGHERLEVQARKFYSQRNMYLCGFTLFLSLILNRTYVMIIDNIKLEDKVQAFESNKNYKENKSSEVAELQKRLAMKEQDLQTLKKQSEGLHRSYDELSDKYAATQVDEGKKGK"
     misc_feature    1..423
                     /locus_tag="G6M90_00g058850"
                     /old_locus_tag="MBR_05601"
                     /note="Bap31/Bap29 transmembrane region; Region: Bap31;
                     pfam05529"
                     /db_xref="CDD:461673"
     misc_feature    457..606
                     /locus_tag="G6M90_00g058850"
                     /old_locus_tag="MBR_05601"
                     /note="Bap31/Bap29 cytoplasmic coiled-coil domain; Region:
                     Bap31_Bap29_C; pfam18035"
                     /db_xref="CDD:465623"
ORIGIN      
atgacgctctactactctctcgtcttcttcctcctcgtcctggagatggtgctctttatgctcctcctaatccctctcccgcacacggccaagcgcaaggtctttaccttcatctccgaaaaccccatcatctccaaggtcatgtactggctcaaaatcacctttgtcttcatcctcatcctgttcatcgacagcgtgaaccgcgtgtaccgcgtgcaactggaagtggtcgccgcgggagaacaggcgtccaagggagctgctattctgggccacgaacgcctcgaagtccaggcgcgtaaattctactcccagcgaaacatgtacctctgcggctttaccctgttcctgtcgctcatcttgaaccgcacctacgtcatgatcattgacaacatcaagctggaggacaaggtccaggcgtttgagagcaacaagaactacaaggagaacaagtcgagtgaggttgccgagctgcagaagcggctggccatgaaggagcaggatttgcagacgctcaagaagcagagtgaggggctgcacaggagctatgacgagctgagcgacaagtacgcggctacgcaggttgacgaggggaagaaggggaaataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]