2024-04-25 17:20:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_014684551 465 bp mRNA linear PLN 05-JAN-2024 DEFINITION Metarhizium brunneum ARSEF 3297 uncharacterized protein (MBR_09803), partial mRNA. ACCESSION XM_014684551 VERSION XM_014684551.1 DBLINK BioProject: PRJNA302307 BioSample: SAMN03268432 KEYWORDS RefSeq. SOURCE Metarhizium brunneum ARSEF 3297 ORGANISM Metarhizium brunneum ARSEF 3297 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae; Metarhizium. REFERENCE 1 (bases 1 to 465) AUTHORS Hu,X., Xiao,G., Zheng,P., Shang,Y., Su,Y., Zhang,X., Liu,X., Zhan,S., St Leger,R.J. and Wang,C. TITLE Trajectory and genomic determinants of fungal-pathogen speciation and host adaptation JOURNAL Proc. Natl. Acad. Sci. U.S.A. 111 (47), 16796-16801 (2014) PUBMED 25368161 REFERENCE 2 (bases 1 to 465) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 465) AUTHORS Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and Wang,C. TITLE Direct Submission JOURNAL Submitted (07-DEC-2013) Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fengling Road, Shanghai, Shanghai 200032, China COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_014574691). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..465 /organism="Metarhizium brunneum ARSEF 3297" /mol_type="mRNA" /strain="ARSEF 3297" /host="Boophilus sp." /db_xref="taxon:1276141" /chromosome="Unknown" /country="Mexico: Colima" /collection_date="1987" gene <1..>465 /locus_tag="MBR_09803" /db_xref="GeneID:26247073" CDS <1..465 /locus_tag="MBR_09803" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_014540037.1" /db_xref="GeneID:26247073" /translation="
MANSAKRILVSVSSKSPYWSEAWESSLQVIETALGLLKESKLVCSDGNQDAKPKFIVKERWNVRTFIVFDIFHDTYDPDTAHLSGQNDLPVISVFLGEIISMNVASNFVENEVNRKVQEIHDATGIGSRPPFSVDHMYGNVPSYPNPRTIISPP"
ORIGIN
atggcaaactctgcgaagcgaattctggtgagcgtctcgagtaagagcccctactggtccgaggcatgggaatccagcttgcaggtgatcgaaacggcacttggactcctcaaagagagcaagctggtttgttccgatggcaaccaagacgcgaaaccgaaatttatcgttaaggagagatggaatgtgcgaacatttatcgtcttcgacatcttccacgacacctacgatcccgatactgcgcatctttcaggtcagaatgacctgccagtcatttcagtcttcttgggcgagataatcagcatgaatgtggcaagcaactttgtggagaatgaagtcaacagaaaagtgcaagaaatccacgatgcgactggaatcggaagtcggcctcctttcagcgtcgatcacatgtatggaaacgtgcctagttatcccaacccgcggactataatatctcctccttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]