2025-10-16 02:26:54, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_014684551 465 bp mRNA linear PLN 26-JUN-2024 DEFINITION Metarhizium brunneum uncharacterized protein (G6M90_00g065090), partial mRNA. ACCESSION XM_014684551 VERSION XM_014684551.1 DBLINK BioProject: PRJNA1128270 BioSample: SAMN15394350 KEYWORDS RefSeq. SOURCE Metarhizium brunneum ORGANISM Metarhizium brunneum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae; Metarhizium. REFERENCE 1 (bases 1 to 465) AUTHORS Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M. TITLE Telomere length de novo assembly of all 7 chromosomes of the fungus, Metarhizium brunneum, using a novel assembly pipeline JOURNAL Unpublished REFERENCE 2 (bases 1 to 465) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (26-JUN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 465) AUTHORS Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M. TITLE Direct Submission JOURNAL Submitted (09-JUL-2020) Biocontrol and Natural Products Group (BANP), Biological Sciences, Swansea University, Singleton Park Campus, Swansea SA28PP, United Kingdom COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_089424). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..465 /organism="Metarhizium brunneum" /mol_type="mRNA" /strain="4556" /host="Boophilus sp. [Acari: Ixodidae]" /db_xref="taxon:500148" /chromosome="3" /geo_loc_name="USA: Florida" /collection_date="29-Sep-1993" gene <1..>465 /locus_tag="G6M90_00g065090" /old_locus_tag="MBR_09803" /db_xref="GeneID:26247073" CDS 1..465 /locus_tag="G6M90_00g065090" /old_locus_tag="MBR_09803" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_014540037.1" /db_xref="GeneID:26247073" /translation="
MANSAKRILVSVSSKSPYWSEAWESSLQVIETALGLLKESKLVCSDGNQDAKPKFIVKERWNVRTFIVFDIFHDTYDPDTAHLSGQNDLPVISVFLGEIISMNVASNFVENEVNRKVQEIHDATGIGSRPPFSVDHMYGNVPSYPNPRTIISPP"
ORIGIN
atggcaaactctgcgaagcgaattctggtgagcgtctcgagtaagagcccctactggtccgaggcatgggaatccagcttgcaggtgatcgaaacggcacttggactcctcaaagagagcaagctggtttgttccgatggcaaccaagacgcgaaaccgaaatttatcgttaaggagagatggaatgtgcgaacatttatcgtcttcgacatcttccacgacacctacgatcccgatactgcgcatctttcaggtcagaatgacctgccagtcatttcagtcttcttgggcgagataatcagcatgaatgtggcaagcaactttgtggagaatgaagtcaacagaaaagtgcaagaaatccacgatgcgactggaatcggaagtcggcctcctttcagcgtcgatcacatgtatggaaacgtgcctagttatcccaacccgcggactataatatctcctccttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]