LOCUS       XM_014684551             465 bp    mRNA    linear   PLN 26-JUN-2024
DEFINITION  Metarhizium brunneum uncharacterized protein (G6M90_00g065090),
            partial mRNA.
ACCESSION   XM_014684551
VERSION     XM_014684551.1
DBLINK      BioProject: PRJNA1128270
            BioSample: SAMN15394350
KEYWORDS    RefSeq.
SOURCE      Metarhizium brunneum
  ORGANISM  Metarhizium brunneum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae;
            Metarhizium.
REFERENCE   1  (bases 1 to 465)
  AUTHORS   Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M.
  TITLE     Telomere length de novo assembly of all 7 chromosomes of the
            fungus, Metarhizium brunneum, using a novel assembly pipeline
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 465)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 465)
  AUTHORS   Saud,z., Kortsinoglou,A., Kouvelis,V.N. and Butt,T.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-2020) Biocontrol and Natural Products Group
            (BANP), Biological Sciences, Swansea University, Singleton Park
            Campus, Swansea SA28PP, United Kingdom
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_089424).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..465
                     /organism="Metarhizium brunneum"
                     /mol_type="mRNA"
                     /strain="4556"
                     /host="Boophilus sp. [Acari: Ixodidae]"
                     /db_xref="taxon:500148"
                     /chromosome="3"
                     /geo_loc_name="USA: Florida"
                     /collection_date="29-Sep-1993"
     gene            <1..>465
                     /locus_tag="G6M90_00g065090"
                     /old_locus_tag="MBR_09803"
                     /db_xref="GeneID:26247073"
     CDS             1..465
                     /locus_tag="G6M90_00g065090"
                     /old_locus_tag="MBR_09803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_014540037.1"
                     /db_xref="GeneID:26247073"
                     /translation="

MANSAKRILVSVSSKSPYWSEAWESSLQVIETALGLLKESKLVCSDGNQDAKPKFIVKERWNVRTFIVFDIFHDTYDPDTAHLSGQNDLPVISVFLGEIISMNVASNFVENEVNRKVQEIHDATGIGSRPPFSVDHMYGNVPSYPNPRTIISPP"

ORIGIN      

atggcaaactctgcgaagcgaattctggtgagcgtctcgagtaagagcccctactggtccgaggcatgggaatccagcttgcaggtgatcgaaacggcacttggactcctcaaagagagcaagctggtttgttccgatggcaaccaagacgcgaaaccgaaatttatcgttaaggagagatggaatgtgcgaacatttatcgtcttcgacatcttccacgacacctacgatcccgatactgcgcatctttcaggtcagaatgacctgccagtcatttcagtcttcttgggcgagataatcagcatgaatgtggcaagcaactttgtggagaatgaagtcaacagaaaagtgcaagaaatccacgatgcgactggaatcggaagtcggcctcctttcagcgtcgatcacatgtatggaaacgtgcctagttatcccaacccgcggactataatatctcctccttga

//