GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 06:51:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_014570120             655 bp    mRNA    linear   VRT 04-JUN-2018
DEFINITION  PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like
            (LOC102448310), partial mRNA.
ACCESSION   XM_014570120
VERSION     XM_014570120.1
DBLINK      BioProject: PRJNA221645
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Pelodiscus sinensis (Chinese soft-shelled turtle)
  ORGANISM  Pelodiscus sinensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Testudinata; Testudines; Cryptodira; Trionychia;
            Trionychidae; Pelodiscus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_005853213.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pelodiscus sinensis Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 24% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..655
                     /organism="Pelodiscus sinensis"
                     /mol_type="mRNA"
                     /isolate="Daiwa-1"
                     /db_xref="taxon:13735"
                     /chromosome="Unknown"
                     /sex="female"
                     /country="Japan: Saga"
     gene            <1..655
                     /gene="LOC102448310"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 72% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:102448310"
     CDS             <1..655
                     /gene="LOC102448310"
                     /codon_start=2
                     /product="homeobox protein Meis3-like"
                     /protein_id="XP_014425606.1"
                     /db_xref="GeneID:102448310"
                     /translation="
RVRRHPLFPLLALVFEKCELATCSPRDPAGSYPGGDVCSSDSFSEDIAVFAKQIRTEKPLFSSDPELDNLIRTEKPLFSSDPELDNLVEPASGSSPTPGHPRCLSPSGCFLAGDCLDTSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWWDGRHPYPSEEQKKQLAQDTGLTILQVNNW"
     misc_feature    101..>217
                     /gene="LOC102448310"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:435375"
     misc_feature    467..>562
                     /gene="LOC102448310"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     misc_feature    575..>652
                     /gene="LOC102448310"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
acgtgtgcgcagacaccccttgttccccttgctggccctggtcttcgagaagtgtgagctggcgacctgttcgccccgggaccccgcgggctcgtaccccggcggagacgtctgctcctccgactccttcagcgaggacatcgccgtgttcgccaaacagatcaggacggaaaagccgctgttctcgtccgaccccgagctggataacttgatcaggacggaaaagccgctgttctcgtccgaccccgagctggataacttggtagagccagcctcgggttcaagtccgactcctggtcacccaaggtgcctttcccccagcggctgcttccttgcaggggactgcctggacaccagcgtggcctcgcccagcactggggacgacgatgacctggaccgggacaagaaacgcaacaagaagcgggggatcttccccaaagtggccactaacatcatgcgggcctggctgttccagcacctgtcgcacccctacccctcggaggagcagaagaagcagctggcgcaggacacggggctcaccatcctgcaggtcaataactggtgggatggaaggcacccctacccctcggaggagcagaagaagcagctggcgcaggacacggggctcaccatcctgcaggtcaataactggtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]