GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 03:51:06, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_014500008             348 bp    mRNA    linear   INV 29-OCT-2015
DEFINITION  PREDICTED: Papilio machaon 40S ribosomal protein S4-A-like
            (LOC106708482), partial mRNA.
ACCESSION   XM_014500008
VERSION     XM_014500008.1
DBLINK      BioProject: PRJNA300299
KEYWORDS    RefSeq.
SOURCE      Papilio machaon (common yellow swallowtail)
  ORGANISM  Papilio machaon
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Holometabola; Lepidoptera; Glossata; Ditrysia;
            Papilionoidea; Papilionidae; Papilioninae; Papilio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_014501090.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Papilio machaon Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..348
                     /organism="Papilio machaon"
                     /mol_type="mRNA"
                     /isolate="ya'a_city_454_Pm"
                     /db_xref="taxon:76193"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole body"
                     /dev_stage="adult"
     gene            <1..348
                     /gene="LOC106708482"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 99% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:106708482"
     CDS             <1..348
                     /gene="LOC106708482"
                     /codon_start=1
                     /product="40S ribosomal protein S4-A-like"
                     /protein_id="XP_014355494.1"
                     /db_xref="GeneID:106708482"
                     /translation="
DTVKIDLASRKVVDFIPFETDKVVYVIRGEDMGRVCVIKHIKEVDYSDSIITVEDFAKKVFTVPSKNLIVIGNSEDNLLISLPAQRGIKLNELEESNIKYGEIVKQEEIEIEEEY"
     misc_feature    52..216
                     /gene="LOC106708482"
                     /note="KOW motif of Ribosomal Protein S4 (RPS4); Region:
                     KOW_RPS4; cd06087"
                     /db_xref="CDD:240511"
     misc_feature    order(85..93,118..120,124..126,130..135,139..141,145..150,
                     184..186,190..192)
                     /gene="LOC106708482"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240511"
     misc_feature    163..297
                     /gene="LOC106708482"
                     /note="40S ribosomal protein S4 C-terminus; Region:
                     40S_S4_C; pfam16121"
                     /db_xref="CDD:292739"
ORIGIN      
gacaccgttaaaattgatttggcttctagaaaagtcgttgatttcattccttttgagactgataaagttgtttacgtcataagaggagaagatatgggaagagtgtgtgttattaaacacatcaaagaagttgattattctgattctattattacagttgaggattttgctaagaaggtctttactgttccttctaagaatctcattgtcatcggtaacagtgaagataatcttttgatttctctaccagcacagagaggaattaaactcaatgaacttgaagagagtaatattaagtacggagagatagtaaaacaagaagagattgagattgaagaagaatattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]