2025-07-13 17:07:02, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_014312835 294 bp mRNA linear PLN 29-DEC-2023 DEFINITION Grosmannia clavigera kw1407 uncharacterized protein (CMQ_4679), partial mRNA. ACCESSION XM_014312835 VERSION XM_014312835.1 DBLINK BioProject: PRJNA264104 BioSample: SAMN02953765 KEYWORDS RefSeq. SOURCE Grosmannia clavigera kw1407 ORGANISM Grosmannia clavigera kw1407 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Sordariomycetidae; Ophiostomatales; Ophiostomataceae; Leptographium. REFERENCE 1 (bases 1 to 294) AUTHORS Diguistini,S., Wang,Y., Liao,N.Y., Taylor,G., Tanguay,P., Feau,N., Henrissat,B., Chan,S.K., Hesse-Orce,U., Alamouti,S.M., Tsui,C.K., Docking,R.T., Levasseur,A., Haridas,S., Robertson,G., Birol,I., Holt,R.A., Marra,M.A., Hamelin,R.C., Hirst,M., Jones,S.J., Bohlmann,J. and Breuil,C. TITLE Genome and transcriptome analyses of the mountain pine beetle-fungal symbiont Grosmannia clavigera, a lodgepole pine pathogen JOURNAL Proc. Natl. Acad. Sci. U.S.A. (2011) In press PUBMED 21262841 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 294) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 294) AUTHORS DiGuistini,S., Wang,Y., Liao,N.Y., Tanguay,P., Feau,N., Henrissat,B., Chan,S.K., Hesse-Orce,U., Alamouti,S.M., Tsui,C.K., Docking,T.R., Levasseur,A., Haridas,S., Robertson,G., Birol,I., Holt,R.A., Marra,M.A., Hirst,M., Hamelin,R.C., Jones,S.J.M., Bohlmann,J.R. and Breuil,C. TITLE Direct Submission JOURNAL Submitted (30-DEC-2010) Wood Science, University of British Columbia, Faculty of Forestry The University of British Columbia 4th floor, Vancouver, British Columbia V6T 1Z4, Canada COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_014040560). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..294 /organism="Grosmannia clavigera kw1407" /mol_type="mRNA" /strain="kw1407" /culture_collection="UAMH:11150" /db_xref="taxon:655863" /chromosome="Unknown" gene <1..>294 /locus_tag="CMQ_4679" /db_xref="GeneID:25977916" CDS 1..294 /locus_tag="CMQ_4679" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_014168310.1" /db_xref="GeneID:25977916" /translation="
MPIRLARIYFRRLTIWSSLLLLTTGYFLFSDVLPDVANHALRKPLRSQWHPIDRLIDEVNMTFHRLLQSRSTNLSDAAARYRERRGRHPPPGFGAWW"
ORIGIN
atgcctatcagactggccaggatttacttcaggcggctgaccatctggagcagtcttttgttgttgaccacgggctacttcctattctcagacgtgttgcccgacgtggccaatcatgccctacgcaagccccttcgctcgcagtggcatcctatcgaccgcttaatcgatgaggtcaacatgacctttcaccgcctcctgcagtcacgctcaacaaacttgagcgatgcagcagcgcgctaccgcgagcggcggggccgtcacccgccgcctggtttcggcgcgtggtggtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]