ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-24 11:49:30, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_014312835 294 bp mRNA linear PLN 29-DEC-2023
DEFINITION Grosmannia clavigera kw1407 uncharacterized protein (CMQ_4679),
partial mRNA.
ACCESSION XM_014312835
VERSION XM_014312835.1
DBLINK BioProject: PRJNA264104
BioSample: SAMN02953765
KEYWORDS RefSeq.
SOURCE Grosmannia clavigera kw1407
ORGANISM Grosmannia clavigera kw1407
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Sordariomycetidae; Ophiostomatales;
Ophiostomataceae; Leptographium.
REFERENCE 1 (bases 1 to 294)
AUTHORS Diguistini,S., Wang,Y., Liao,N.Y., Taylor,G., Tanguay,P., Feau,N.,
Henrissat,B., Chan,S.K., Hesse-Orce,U., Alamouti,S.M., Tsui,C.K.,
Docking,R.T., Levasseur,A., Haridas,S., Robertson,G., Birol,I.,
Holt,R.A., Marra,M.A., Hamelin,R.C., Hirst,M., Jones,S.J.,
Bohlmann,J. and Breuil,C.
TITLE Genome and transcriptome analyses of the mountain pine
beetle-fungal symbiont Grosmannia clavigera, a lodgepole pine
pathogen
JOURNAL Proc. Natl. Acad. Sci. U.S.A. (2011) In press
PUBMED 21262841
REMARK Publication Status: Available-Online prior to print
REFERENCE 2 (bases 1 to 294)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 294)
AUTHORS DiGuistini,S., Wang,Y., Liao,N.Y., Tanguay,P., Feau,N.,
Henrissat,B., Chan,S.K., Hesse-Orce,U., Alamouti,S.M., Tsui,C.K.,
Docking,T.R., Levasseur,A., Haridas,S., Robertson,G., Birol,I.,
Holt,R.A., Marra,M.A., Hirst,M., Hamelin,R.C., Jones,S.J.M.,
Bohlmann,J.R. and Breuil,C.
TITLE Direct Submission
JOURNAL Submitted (30-DEC-2010) Wood Science, University of British
Columbia, Faculty of Forestry The University of British Columbia
4th floor, Vancouver, British Columbia V6T 1Z4, Canada
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_014040560).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..294
/organism="Grosmannia clavigera kw1407"
/mol_type="mRNA"
/strain="kw1407"
/culture_collection="UAMH:11150"
/db_xref="taxon:655863"
/chromosome="Unknown"
gene <1..>294
/locus_tag="CMQ_4679"
/db_xref="GeneID:25977916"
CDS 1..294
/locus_tag="CMQ_4679"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_014168310.1"
/db_xref="GeneID:25977916"
/translation="
MPIRLARIYFRRLTIWSSLLLLTTGYFLFSDVLPDVANHALRKPLRSQWHPIDRLIDEVNMTFHRLLQSRSTNLSDAAARYRERRGRHPPPGFGAWW"
ORIGIN
atgcctatcagactggccaggatttacttcaggcggctgaccatctggagcagtcttttgttgttgaccacgggctacttcctattctcagacgtgttgcccgacgtggccaatcatgccctacgcaagccccttcgctcgcagtggcatcctatcgaccgcttaatcgatgaggtcaacatgacctttcaccgcctcctgcagtcacgctcaacaaacttgagcgatgcagcagcgcgctaccgcgagcggcggggccgtcacccgccgcctggtttcggcgcgtggtggtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]