GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 13:37:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_014090450             627 bp    mRNA    linear   PLN 29-DEC-2023
DEFINITION  Trichoderma atroviride IMI 206040 uncharacterized protein
            (TRIATDRAFT_81085), partial mRNA.
ACCESSION   XM_014090450
VERSION     XM_014090450.1
DBLINK      BioProject: PRJNA264112
            BioSample: SAMN02744066
KEYWORDS    RefSeq.
SOURCE      Trichoderma atroviride IMI 206040
  ORGANISM  Trichoderma atroviride IMI 206040
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae;
            Trichoderma.
REFERENCE   1  (bases 1 to 627)
  AUTHORS   Kubicek,C.P., Herrera-Estrella,A., Seidl-Seiboth,V., Martinez,D.A.,
            Druzhinina,I.S., Thon,M., Zeilinger,S., Casas-Flores,S.,
            Horwitz,B.A., Mukherjee,P.K., Mukherjee,M., Kredics,L.,
            Alcaraz,L.D., Aerts,A., Antal,Z., Atanasova,L.,
            Cervantes-Badillo,M.G., Challacombe,J., Chertkov,O., McCluskey,K.,
            Coulpier,F., Deshpande,N., von Dohren,H., Ebbole,D.J.,
            Esquivel-Naranjo,E.U., Fekete,E., Flipphi,M., Glaser,F.,
            Gomez-Rodriguez,E.Y., Gruber,S., Han,C., Henrissat,B., Hermosa,R.,
            Hernandez-Onate,M., Karaffa,L., Kosti,I., Le Crom,S., Lindquist,E.,
            Lucas,S., Lubeck,M., Lubeck,P.S., Margeot,A., Metz,B., Misra,M.,
            Nevalainen,H., Omann,M., Packer,N., Perrone,G., Uresti-Rivera,E.E.,
            Salamov,A., Schmoll,M., Seiboth,B., Shapiro,H., Sukno,S.,
            Tamayo-Ramos,J.A., Tisch,D., Wiest,A., Wilkinson,H.H., Zhang,M.,
            Coutinho,P.M., Kenerley,C.M., Monte,E., Baker,S.E. and
            Grigoriev,I.V.
  TITLE     Comparative genome sequence analysis underscores mycoparasitism as
            the ancestral life style of Trichoderma
  JOURNAL   Genome Biol. 12 (4), R40 (2011)
   PUBMED   21501500
REFERENCE   2  (bases 1 to 627)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 627)
  AUTHORS   Aerts,A., Kubicek,C.P., Herrera-Estrella,A., Seidl,V., Le Crom,S.,
            Martinez,D.A., Druzhinina,I.S., Zeilinger,S., Casas-Flores,S.,
            Horwitz,B.A., Mukherjee,P.K., Mukherjee,M., Kredics,L.,
            Alcaraz,L.D., Antal,Z., Atanasova,L., Cervantes-Badillo,M.G.,
            Challacombe,J., Chertkov,O., McCluskey,K., Coulpier,F.,
            Deshpande,N., von Doehren,H., Ebbole,D.J., Esquivel-Naranjo,E.U.,
            Fekete,E., Flipphi,M., Glaser,F., Gomez-Rodriguez,E.Y., Gruber,S.,
            Han,C., Henrissat,B., Hermosa,R., Hernandez-Onate,M., Karaffa,L.,
            Kosti,I., Lindquist,E., Lucas,S., Lubeck,M., Lubeck,P.S.,
            Margeot,A., Metz,B., Misra,M., Nevalainen,H., Omann,M., Packer,N.,
            Perrone,G., Uresti-Rivera,E.E., Salamov,A., Schmoll,M., Seiboth,B.,
            Shapiro,H., Sukno,S., Tamayo-Ramos,J.A., Thon,M., Tisch,D.,
            Wiest,A., Wilkinson,H.H., Zhang,M., Coutinho,P.M., Kenerley,C.M.,
            Monte,E., Baker,S.E. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
REFERENCE   4  (bases 1 to 627)
  AUTHORS   Bristow,J., Rubin,E., Lucas,S., Glavina del Rio,T., Dalin,E.,
            Tice,H., Bruce,D., Barry,K., Shapiro,H., Pitluck,S., Baker,S.E.,
            Bruno,K.S. and Kubicek,C.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUL-2007) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_014013636).
            
            ##Metadata-START##
            Organism Display Name :: Trichoderma atroviride IMI 206040
            GOLD Stamp ID         :: Gi01368
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..627
                     /organism="Trichoderma atroviride IMI 206040"
                     /mol_type="mRNA"
                     /strain="IMI 206040"
                     /db_xref="taxon:452589"
                     /chromosome="Unknown"
     gene            <1..>627
                     /locus_tag="TRIATDRAFT_81085"
                     /db_xref="GeneID:25785554"
     CDS             1..627
                     /locus_tag="TRIATDRAFT_81085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_013945925.1"
                     /db_xref="GeneID:25785554"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="JGIDB:Triat2_81085"
                     /translation="
MAARSSVSALHYLAIGRLGRGEVVNLFLKDAGIEYQDIRYPYDDTWSRSSEELKRKGLTRTGKVPAVEYKGVTLNQHIPTLRYIARDLGRYDGETNWEKFIVDAVSDVYIDWRFKWVQNLGQATDEYKNKFAPSYYDTIAQYYGETDGPYLLGDKVTYADFAVYQSIDNDQRTGTLPANLSTSITKFKETFEQRPNIAQYIKENLPKL"
     misc_feature    28..258
                     /locus_tag="TRIATDRAFT_81085"
                     /note="GST_N family, Class Sigma_like; composed of GSTs
                     belonging to class Sigma and similar proteins, including
                     GSTs from class Mu, Pi and Alpha. GSTs are cytosolic
                     dimeric proteins involved in cellular detoxification by
                     catalyzing the conjugation of...; Region:
                     GST_N_Sigma_like; cd03039"
                     /db_xref="CDD:239337"
     misc_feature    order(34..36,58..60,187..195,226..231)
                     /locus_tag="TRIATDRAFT_81085"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239337"
     misc_feature    order(40..42,52..60,64..69,73..78,85..90,115..117,
                     232..234,244..246,253..255)
                     /locus_tag="TRIATDRAFT_81085"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239337"
     misc_feature    order(184..186,223..228,232..234,244..246,256..258)
                     /locus_tag="TRIATDRAFT_81085"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239337"
     misc_feature    328..609
                     /locus_tag="TRIATDRAFT_81085"
                     /note="Glutathione S-transferase, C-terminal domain;
                     Region: GST_C_3; pfam14497"
                     /db_xref="CDD:433993"
ORIGIN      
atggcagctcggtcttccgtttcggctcttcattatttggccattggccgactcggtcgtggtgaagtagtcaatctcttcttgaaagacgcgggaattgaataccaagacatccgatatccttatgatgacacttggtcccggagcagcgaggagctgaagcggaagggactgacaaggactggtaaagtccctgcagtagaatacaagggtgtgactttgaatcagcatattccaaccttgcgctatatcgcccgagatcttggccgctatgatggagaaacaaactgggaaaagtttattgtagacgcagtatcggatgtttacattgattggagattcaaatgggttcaaaatcttgggcaagcaacggacgagtataagaacaagtttgcgccaagttattacgacacaatagcgcagtattacggcgaaactgatggcccttacttgctgggcgacaaagtcacctacgctgattttgctgtttatcagtctattgacaatgaccaaaggacagggactctaccagcaaacctgtctacctctatcacaaagttcaaagagacattcgaacagcgcccaaacattgcacagtatatcaaggagaacttgccaaagctttag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]