2024-03-29 13:37:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_014090450 627 bp mRNA linear PLN 29-DEC-2023 DEFINITION Trichoderma atroviride IMI 206040 uncharacterized protein (TRIATDRAFT_81085), partial mRNA. ACCESSION XM_014090450 VERSION XM_014090450.1 DBLINK BioProject: PRJNA264112 BioSample: SAMN02744066 KEYWORDS RefSeq. SOURCE Trichoderma atroviride IMI 206040 ORGANISM Trichoderma atroviride IMI 206040 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae; Trichoderma. REFERENCE 1 (bases 1 to 627) AUTHORS Kubicek,C.P., Herrera-Estrella,A., Seidl-Seiboth,V., Martinez,D.A., Druzhinina,I.S., Thon,M., Zeilinger,S., Casas-Flores,S., Horwitz,B.A., Mukherjee,P.K., Mukherjee,M., Kredics,L., Alcaraz,L.D., Aerts,A., Antal,Z., Atanasova,L., Cervantes-Badillo,M.G., Challacombe,J., Chertkov,O., McCluskey,K., Coulpier,F., Deshpande,N., von Dohren,H., Ebbole,D.J., Esquivel-Naranjo,E.U., Fekete,E., Flipphi,M., Glaser,F., Gomez-Rodriguez,E.Y., Gruber,S., Han,C., Henrissat,B., Hermosa,R., Hernandez-Onate,M., Karaffa,L., Kosti,I., Le Crom,S., Lindquist,E., Lucas,S., Lubeck,M., Lubeck,P.S., Margeot,A., Metz,B., Misra,M., Nevalainen,H., Omann,M., Packer,N., Perrone,G., Uresti-Rivera,E.E., Salamov,A., Schmoll,M., Seiboth,B., Shapiro,H., Sukno,S., Tamayo-Ramos,J.A., Tisch,D., Wiest,A., Wilkinson,H.H., Zhang,M., Coutinho,P.M., Kenerley,C.M., Monte,E., Baker,S.E. and Grigoriev,I.V. TITLE Comparative genome sequence analysis underscores mycoparasitism as the ancestral life style of Trichoderma JOURNAL Genome Biol. 12 (4), R40 (2011) PUBMED 21501500 REFERENCE 2 (bases 1 to 627) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 627) AUTHORS Aerts,A., Kubicek,C.P., Herrera-Estrella,A., Seidl,V., Le Crom,S., Martinez,D.A., Druzhinina,I.S., Zeilinger,S., Casas-Flores,S., Horwitz,B.A., Mukherjee,P.K., Mukherjee,M., Kredics,L., Alcaraz,L.D., Antal,Z., Atanasova,L., Cervantes-Badillo,M.G., Challacombe,J., Chertkov,O., McCluskey,K., Coulpier,F., Deshpande,N., von Doehren,H., Ebbole,D.J., Esquivel-Naranjo,E.U., Fekete,E., Flipphi,M., Glaser,F., Gomez-Rodriguez,E.Y., Gruber,S., Han,C., Henrissat,B., Hermosa,R., Hernandez-Onate,M., Karaffa,L., Kosti,I., Lindquist,E., Lucas,S., Lubeck,M., Lubeck,P.S., Margeot,A., Metz,B., Misra,M., Nevalainen,H., Omann,M., Packer,N., Perrone,G., Uresti-Rivera,E.E., Salamov,A., Schmoll,M., Seiboth,B., Shapiro,H., Sukno,S., Tamayo-Ramos,J.A., Thon,M., Tisch,D., Wiest,A., Wilkinson,H.H., Zhang,M., Coutinho,P.M., Kenerley,C.M., Monte,E., Baker,S.E. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (18-MAY-2011) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA REFERENCE 4 (bases 1 to 627) AUTHORS Bristow,J., Rubin,E., Lucas,S., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Barry,K., Shapiro,H., Pitluck,S., Baker,S.E., Bruno,K.S. and Kubicek,C.P. TITLE Direct Submission JOURNAL Submitted (05-JUL-2007) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_014013636). ##Metadata-START## Organism Display Name :: Trichoderma atroviride IMI 206040 GOLD Stamp ID :: Gi01368 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..627 /organism="Trichoderma atroviride IMI 206040" /mol_type="mRNA" /strain="IMI 206040" /db_xref="taxon:452589" /chromosome="Unknown" gene <1..>627 /locus_tag="TRIATDRAFT_81085" /db_xref="GeneID:25785554" CDS 1..627 /locus_tag="TRIATDRAFT_81085" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_013945925.1" /db_xref="GeneID:25785554" /db_xref="InterPro:IPR004045" /db_xref="InterPro:IPR004046" /db_xref="JGIDB:Triat2_81085" /translation="
MAARSSVSALHYLAIGRLGRGEVVNLFLKDAGIEYQDIRYPYDDTWSRSSEELKRKGLTRTGKVPAVEYKGVTLNQHIPTLRYIARDLGRYDGETNWEKFIVDAVSDVYIDWRFKWVQNLGQATDEYKNKFAPSYYDTIAQYYGETDGPYLLGDKVTYADFAVYQSIDNDQRTGTLPANLSTSITKFKETFEQRPNIAQYIKENLPKL"
misc_feature 28..258 /locus_tag="TRIATDRAFT_81085" /note="GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of...; Region: GST_N_Sigma_like; cd03039" /db_xref="CDD:239337" misc_feature order(34..36,58..60,187..195,226..231) /locus_tag="TRIATDRAFT_81085" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239337" misc_feature order(40..42,52..60,64..69,73..78,85..90,115..117, 232..234,244..246,253..255) /locus_tag="TRIATDRAFT_81085" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239337" misc_feature order(184..186,223..228,232..234,244..246,256..258) /locus_tag="TRIATDRAFT_81085" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239337" misc_feature 328..609 /locus_tag="TRIATDRAFT_81085" /note="Glutathione S-transferase, C-terminal domain; Region: GST_C_3; pfam14497" /db_xref="CDD:433993" ORIGIN
atggcagctcggtcttccgtttcggctcttcattatttggccattggccgactcggtcgtggtgaagtagtcaatctcttcttgaaagacgcgggaattgaataccaagacatccgatatccttatgatgacacttggtcccggagcagcgaggagctgaagcggaagggactgacaaggactggtaaagtccctgcagtagaatacaagggtgtgactttgaatcagcatattccaaccttgcgctatatcgcccgagatcttggccgctatgatggagaaacaaactgggaaaagtttattgtagacgcagtatcggatgtttacattgattggagattcaaatgggttcaaaatcttgggcaagcaacggacgagtataagaacaagtttgcgccaagttattacgacacaatagcgcagtattacggcgaaactgatggcccttacttgctgggcgacaaagtcacctacgctgattttgctgtttatcagtctattgacaatgaccaaaggacagggactctaccagcaaacctgtctacctctatcacaaagttcaaagagacattcgaacagcgcccaaacattgcacagtatatcaaggagaacttgccaaagctttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]