2024-05-20 08:27:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_013960938 1127 bp mRNA linear VRT 09-SEP-2015 DEFINITION PREDICTED: Apteryx australis mantelli ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (ST6GALNAC5), mRNA. ACCESSION XM_013960938 VERSION XM_013960938.1 DBLINK BioProject: PRJNA294519 KEYWORDS RefSeq. SOURCE Apteryx mantelli mantelli ORGANISM Apteryx mantelli mantelli Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Palaeognathae; Apterygiformes; Apterygidae; Apteryx; Apteryx mantelli. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_014006747.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Apteryx australis mantelli Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1127 /organism="Apteryx mantelli mantelli" /mol_type="mRNA" /sub_species="mantelli" /db_xref="taxon:202946" /chromosome="Unknown" gene 1..1127 /gene="ST6GALNAC5" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 9 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:106499452" CDS 13..753 /gene="ST6GALNAC5" /codon_start=1 /product="alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5" /protein_id="XP_013816392.1" /db_xref="GeneID:106499452" /translation="
MHCKSCALVTSSGHLLGSKQGDKIDQTECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKAYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPLGPDECTMYISHERGRKGSHHRFITEKRVFENWARTFNIRFFQPDWKPEPLTVNHPEIKPVV"
misc_feature 16..561 /gene="ST6GALNAC5" /note="Glycosyltransferase family 29 (sialyltransferase); Region: Glyco_transf_29; pfam00777" /db_xref="CDD:425864" ORIGIN
cagcctttaaaaatgcactgcaagagttgtgcattggtaaccagttctggacaccttctgggaagtaaacaaggtgacaaaatcgaccagactgagtgtgtaatacgaatgaacgatgcacctactcgaggttatggaaaagatgtgggaaacaaaacaagccttcgagtcattgcacactctagtattcagaggattttacgaaatcgcaacgaactcttaaatatgagccatggagctgtatttatcttctggggtcctagcagctacatgaggagagatggaaaaggcttggtgtataataacctgcagctgatgaatcagatactgcctcaattaaaagcatatatgatttctcgccacaagatgcttcaatttgatgacctttttaaacgggaaaccgggaaagacaggaagatatccaacacttggcttagcacgggctggttcacaatgactatcgcattagagctctgtgacaggataaatgtttatggcatggtgccaccggatttctgcagggatcctaatcatctttcagtaccttatcattattacgaacctttgggacctgatgaatgcacaatgtacatttcccacgagcggggccgaaagggcagccatcatcgtttcatcacagagaaacgagtgtttgagaactgggcacggacattcaatattcgctttttccaaccagactggaaaccagaaccacttactgtaaatcaccctgagattaaaccggtggtctgagggatgaacacagaagactgcaatcacagtcacctactgtatcagctttcagggtgtttgttggaccttctgggacagcaagcagcctagagaagagtaacaggatttgcagatgagaactgcgacaacagtcaggaagtatgatggagtatatccagagtattttgtgtcaaactgtacattaaaccagtatatagccttttctggccatctgacttcctgtatgtgtatgtaatttgtgaaaagcaacttgagtatcattaatgggatggttaattcattatgttttttttaagtacaatgccactgaattttcatagtgaaaacttacagtacttatttaatgcaggtttttatgcaacctaggccagtat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]