GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 09:23:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_013731591             831 bp    mRNA    linear   PLN 25-AUG-2015
DEFINITION  PREDICTED: Brassica oleracea var. oleracea calcium-transporting
            ATPase 9, plasma membrane-type-like (LOC106295625), transcript
            variant X2, mRNA.
ACCESSION   XM_013731591
VERSION     XM_013731591.1
DBLINK      BioProject: PRJNA293438
KEYWORDS    RefSeq.
SOURCE      Brassica oleracea var. oleracea
  ORGANISM  Brassica oleracea var. oleracea
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Brassiceae; Brassica.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_013617406.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Brassica oleracea Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..831
                     /organism="Brassica oleracea var. oleracea"
                     /mol_type="mRNA"
                     /variety="oleracea"
                     /cultivar="TO1000"
                     /db_xref="taxon:109376"
                     /chromosome="C1"
                     /country="Canada"
                     /lat_lon="52.1333 N 106.6833 W"
                     /collection_date="31-Aug-2009"
     gene            1..831
                     /gene="LOC106295625"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:106295625"
     CDS             384..635
                     /gene="LOC106295625"
                     /codon_start=1
                     /product="calcium-transporting ATPase 9, plasma
                     membrane-type-like isoform X2"
                     /protein_id="XP_013587045.1"
                     /db_xref="GeneID:106295625"
                     /translation="
MTGESKIVRLNGLATFIGIVGLTVALVVLVRRLSACETMGSATTICSDKTGTLTLNRMNMSMRFIVLITMSPGSFPPLQLTLK"
     misc_feature    <468..>557
                     /gene="LOC106295625"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      
tcttcctttctatctcttcctctcacattctctctttccctcctcctcaattttcctataaagcttcgaactttaagctctcctcctcatgggttctccttgtttctctccctatattggtttaaagcatatgggcatctccatctccccgaaatcttcgaacccagagaagaagagaagatgtagtaagggtttggtgattcgtgcgtctttgtttggcgttggagcacatgaggcttacaggtcatgagaggaaggagaacagtgaagatatcaatctacgacattgttgtcggagatgttatacctcttagaataggtgaccgggtccctgcggatggagtgctaattagtggtcattctcttgctattgtgaatctagcatgacgggtgaaagcaagattgtgcggttaaacggtcttgcaaccttcatcggtatagtggggctcacggtggctcttgttgtactggttaggaggctttcagcttgtgaaaccatgggttcagcaacaacaatttgcagtgataaaactggaactttaactttgaatcggatgaacatgtctatgaggttcatcgttctgatcaccatgtcaccaggttcgttccctcccttacagctcactcttaaatgaacatgtcttgattctggttggtgttagatatatggttagtgttagtgttaaatgtggttagtgaacatcgttctgaacatcgtagtgaagcttgtaatcttgtgtattcatgtgtcacgggagcttgtagtcttgtaatcttctctatattaagttttggtaaaaccaaacaatttgatcgcaaattttcttgttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]