LOCUS       XM_013437053             207 bp    mRNA    linear   INV 12-AUG-2015
DEFINITION  Necator americanus hypothetical protein mRNA.
ACCESSION   XM_013437053
VERSION     XM_013437053.1
DBLINK      BioProject: PRJNA279932
            BioSample: SAMN02953824
KEYWORDS    RefSeq.
SOURCE      Necator americanus (New World hookworm)
  ORGANISM  Necator americanus
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Strongyloidea; Ancylostomatidae;
            Bunostominae; Necator.
REFERENCE   1  (bases 1 to 207)
  AUTHORS   Mitreva,M.
  TITLE     Draft genome of the hookworm Necator americanus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 207)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-AUG-2015) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 207)
  AUTHORS   Mitreva,M., Abubucker,S., Martin,J., Minx,P., Warren,C.,
            Pepin,K.H., Palsikar,V.B., Zhang,X.W.E. and Wilson,R.K.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-APR-2013) The Genome Institute, Washington University
            School of Medicine, 4444 Forest Park, St. Louis, MO 63108, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_013550952).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..207
                     /organism="Necator americanus"
                     /mol_type="mRNA"
                     /host="Homo sapiens"
                     /db_xref="taxon:51031"
                     /chromosome="Unknown"
                     /lab_host="hamster"
                     /country="China: Hunan Province"
     gene            <1..>207
                     /locus_tag="NECAME_04971"
                     /db_xref="GeneID:25345003"
     CDS             1..207
                     /locus_tag="NECAME_04971"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_013292507.1"
                     /db_xref="GeneID:25345003"
                     /translation="

MHMRSEPIGLPEFASLKQHALNVGSQKLYFCGRLMTLNKISFQLCMPSAKNTPPSAAQYMGQMPGSPG"

ORIGIN      

atgcacatgcgatcagagccaataggactgccagagtttgcatcgctgaaacaacacgctctcaatgtcggatcacaaaaactgtatttctgtggccgtcttatgaccttgaacaagatctcgttccagctatgcatgccatcagcgaagaacacaccaccatcggcagcacaatacatgggacaaatgccaggctctcctggatga

//