2025-09-18 05:13:18, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_013407183 288 bp mRNA linear PLN 05-JAN-2024 DEFINITION Exophiala aquamarina CBS 119918 uncharacterized protein (A1O9_04897), partial mRNA. ACCESSION XM_013407183 VERSION XM_013407183.1 DBLINK BioProject: PRJNA292601 BioSample: SAMN00974103 KEYWORDS RefSeq. SOURCE Exophiala aquamarina CBS 119918 ORGANISM Exophiala aquamarina CBS 119918 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Chaetothyriomycetidae; Chaetothyriales; Herpotrichiellaceae; Exophiala. REFERENCE 1 (bases 1 to 288) AUTHORS Cuomo,C., de Hoog,S., Gorbushina,A., Walker,B., Young,S.K., Zeng,Q., Gargeya,S., Fitzgerald,M., Haas,B., Abouelleil,A., Allen,A.W., Alvarado,L., Arachchi,H.M., Berlin,A.M., Chapman,S.B., Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M., Howarth,C., Imamovic,A., Ireland,A., Larimer,J., McCowan,C., Murphy,C., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T., Sisk,P., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE The Genome Sequence of Exophiala aquamarina CBS 119918 JOURNAL Unpublished REFERENCE 2 (bases 1 to 288) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 288) AUTHORS Cuomo,C., de Hoog,S., Gorbushina,A., Walker,B., Young,S.K., Zeng,Q., Gargeya,S., Fitzgerald,M., Haas,B., Abouelleil,A., Allen,A.W., Alvarado,L., Arachchi,H.M., Berlin,A.M., Chapman,S.B., Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M., Howarth,C., Imamovic,A., Ireland,A., Larimer,J., McCowan,C., Murphy,C., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T., Sisk,P., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE Direct Submission JOURNAL Submitted (27-MAR-2013) Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA 02142, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_013550585). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..288 /organism="Exophiala aquamarina CBS 119918" /mol_type="mRNA" /strain="CBS 119918" /culture_collection="CBS:119918" /type_material="culture from type material of Exophiala aquamarina" /db_xref="taxon:1182545" /chromosome="Unknown" gene <1..>288 /locus_tag="A1O9_04897" /db_xref="GeneID:25279824" CDS 1..288 /locus_tag="A1O9_04897" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_013262637.1" /db_xref="GeneID:25279824" /translation="
MPDNPQFLGPLLPQHIAETINVSIGPSGENREYLLHLQDALEALSAHSHDEHIADLARRVRALDPPTRPACPSSIGHDLRKINSTEEQEEIEKDT"
misc_feature <4..189 /locus_tag="A1O9_04897" /note="Gamma-glutamylcyclotransferase ChaC2 (glutathione degradation) [Inorganic ion transport and metabolism]; Region: ChaC2; COG3703" /db_xref="CDD:442917" ORIGIN
atgccagacaatccacagtttcttggaccactactcccgcaacacattgccgaaaccatcaacgtcagcattggacccagtggcgagaacagggagtatctcttgcatctccaagatgccctagaagctctgagtgctcacagccatgacgaacatattgccgatctagcacgaagagtgcgtgctttggatccacctacgcggccggcatgtccttcttcaatcggccacgacttgaggaagattaacagcaccgaagaacaagaagagattgagaaggatacatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]