LOCUS       XM_013115388             923 bp    mRNA    linear   ROD 14-APR-2021
DEFINITION  PREDICTED: Mesocricetus auratus copper chaperone for superoxide
            dismutase (Ccs), transcript variant X2, mRNA.
ACCESSION   XM_013115388
VERSION     XM_013115388.3
DBLINK      BioProject: PRJNA719779
KEYWORDS    RefSeq.
SOURCE      Mesocricetus auratus (golden hamster)
  ORGANISM  Mesocricetus auratus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Cricetidae; Cricetinae; Mesocricetus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024429182.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 14, 2021 this sequence version replaced XM_013115388.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Mesocricetus auratus Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..923
                     /organism="Mesocricetus auratus"
                     /mol_type="mRNA"
                     /isolate="SY011"
                     /db_xref="taxon:10036"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="liver"
                     /dev_stage="adult"
     gene            1..923
                     /gene="Ccs"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 181
                     samples with support for all annotated introns"
                     /db_xref="GeneID:101842998"
     CDS             85..771
                     /gene="Ccs"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_012970842.1"
                     /db_xref="GeneID:101842998"
                     /translation="

MASDSGDGGTMCALEFAVQMTCQSCVDAVHKTLKGVAENLGAAVAILEGSNTIQGVVRFLQLNSELCLIEGTIDGLEPGLHGFHVHQYGDLTKDCNSCGDHFNPDGTSHGGPQDTDRHLGDLGNVLADADGRATFRIEDKQLKVWDVIGRSLVVDEGEDDLGRGSHPLSKITGNSGKRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGEGRKDSVQPPAHL"

     misc_feature    order(214..216,220..222,250..252,256..258,346..354,
                     526..531)
                     /gene="Ccs"
                     /note="E-class dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238186"
     misc_feature    241..636
                     /gene="Ccs"
                     /note="Copper/zinc superoxide dismutase (SODC); Region:
                     Sod_Cu; pfam00080"
                     /db_xref="CDD:425456"
     misc_feature    order(286..288,460..462)
                     /gene="Ccs"
                     /note="P-class dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238186"
     misc_feature    order(334..336,340..342,385..387,436..438,445..447,
                     547..549)
                     /gene="Ccs"
                     /note="active site"
                     /db_xref="CDD:238186"
     misc_feature    order(334..336,340..342,385..387,547..549)
                     /gene="Ccs"
                     /note="Cu2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238186"
     misc_feature    order(385..387,409..411,436..438,445..447)
                     /gene="Ccs"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238186"
ORIGIN      

ggctccgcccaccccacaagactgagcagtgttgctctctggaccctaactgttttgcggcccaggcggttgactatatccaggatggcttcggattccggggacggtggaaccatgtgtgcactggagtttgcagtgcagatgacctgtcagagctgcgtggacgcggtgcacaagaccctgaaaggggtggcagagaatctgggagcagcagtagccattctggagggctctaacaccatacagggcgtggtccgcttcctacagctgaactctgaactctgcctgattgagggaaccattgacggcctagagcccgggctgcatggattccatgttcatcagtatggggatctcacaaaggattgcaatagctgtggggaccattttaaccctgatggaacatctcatgggggccctcaggacactgatcggcacctgggagatctagggaatgtcctggctgatgctgatggtcgagccaccttccggatagaggataaacagctgaaggtgtgggatgtgattggccgcagcctggttgttgatgagggagaagatgacctgggccggggaagccatcccttatccaagatcacagggaactctgggaagaggttggcctgtggcatcattgcacgctctgcgggccttttccagaaccccaagcagatctgctcctgtgatggcctcactatctgggaggagcgaggccggcccattgctggtgaaggccgaaaggactcagtccagccccctgctcacctctgatcaaggcctcgggttattttgtccccctagctgaacatctactgcatagggaacagggggggctttgcttgtgtagacctaggcagactaagtacagggcaggtaggggttgctgcattcttagcaaattaaattgttattttcatatggta

//