2024-05-18 15:49:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_013042318 252 bp mRNA linear PLN 29-JUN-2015 DEFINITION Blastocystis hominis mRNA. ACCESSION XM_013042318 VERSION XM_013042318.1 DBLINK BioProject: PRJNA263384 KEYWORDS RefSeq. SOURCE Blastocystis hominis ORGANISM Blastocystis hominis Eukaryota; Sar; Stramenopiles; Bigyra; Opalozoa; Opalinata; Blastocystidae; Blastocystis. REFERENCE 1 AUTHORS Wincker,P. TITLE Sequencing and annotation of the Blastocystis hominis genome JOURNAL Unpublished REFERENCE 2 (bases 1 to 252) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (26-JUN-2015) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 252) AUTHORS Wincker,P. TITLE Direct Submission JOURNAL Submitted (12-FEB-2010) Wincker P., Genoscope - CEA, Sequencing, 2 rue Gaston Cremieux, F-91057, FRANCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_013171838). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..252 /organism="Blastocystis hominis" /mol_type="mRNA" /isolate="Singapore isolate B (sub-type 7)" /db_xref="taxon:12968" /note="scaffold_3" gene <1..>252 /locus_tag="GSBLH_T00003551001" /db_xref="GeneID:24920642" CDS 1..252 /locus_tag="GSBLH_T00003551001" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_012897772.1" /db_xref="GeneID:24920642" /db_xref="UniProtKB/TrEMBL:D8M6H1" /translation="
MNCIVLNEWSGLTSNLVKLGLGSVSMFFDILFMIQHFILYPSHEEPAEEKLITDEVEALVLEKRDFVRSGSNRIIDISVIKTP"
misc_feature <22..219 /locus_tag="GSBLH_T00003551001" /note="retinal-specific rim ABC transporter; Region: rim_protein; TIGR01257" /db_xref="CDD:130324" ORIGIN
atgaattgcatcgttctgaacgagtggtccggattaacgagtaatcttgtgaagctggggttaggttccgtcagcatgttcttcgacattctgttcatgatccagcactttatcctgtaccctagccatgaggagccagcggaagaaaagctcatcaccgatgaagtggaagctctcgttttggagaagcgtgattttgttcgttcgggcagcaaccgaatcattgatattagtgttattaagaccccgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]