LOCUS       XM_012898411             411 bp    mRNA    linear   INV 15-JUN-2015
DEFINITION  Acytostelium subglobosum LB1 hypothetical protein partial mRNA.
ACCESSION   XM_012898411
VERSION     XM_012898411.1
DBLINK      BioProject: PRJNA280978
            BioSample: SAMD00019534
KEYWORDS    RefSeq.
SOURCE      Acytostelium subglobosum LB1
  ORGANISM  Acytostelium subglobosum LB1
            Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia;
            Acytosteliales; Acytosteliaceae; Acytostelium.
REFERENCE   1
  AUTHORS   Urushihara,H., Kuwayama,H., Fukuhara,K., Ithoh,T., Kagoshima,H.,
            Shin-I,T., Ohishi,K., Taniguchi,T., Noguchi,H., Kuroki,Y., Hata,T.,
            Uchi,K., Mohri,K., Kohara,Y. and Fujiyama,Y.
  TITLE     Comparative genome and transcriptome analyses of the social amoeba
            Acytostelium subglobosum that accomplishes multicellular
            development without germ-soma differentiation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 411)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2015) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 411)
  AUTHORS   Urushihara,H., Itoh,T., Shin-I,T. and Fujiyama,A.
  CONSRTM   Acytostelium Genome Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (05-SEP-2014) Contact:Hideko Urushihara University of
            Tsukuba, Faculty of Life and Environmental Sciences; Tennodai
            1-1-1, Tsukuba, Ibaraki 305-8572, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_012236521).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..411
                     /organism="Acytostelium subglobosum LB1"
                     /mol_type="mRNA"
                     /strain="LB1"
                     /db_xref="taxon:1410327"
                     /note="scaffold: scaffold12"
     gene            <1..>411
                     /locus_tag="SAMD00019534_065910"
                     /db_xref="GeneID:24521918"
     CDS             <1..411
                     /locus_tag="SAMD00019534_065910"
                     /note="ADB0002164;
                     ASU06623;
                     homolog of Dictyostelium discoideum cofB"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_012753865.1"
                     /db_xref="GeneID:24521918"
                     /translation="

STGVKLANNCMEIFDQMKIRRQYGIVFYKLNDDNTQIVVEKTLPYGSPFTTFLTELPPTECRYVLVDFAYTEESTSKKRLVFVSWCPGTSSIRSRMIYTASKDALRKALVGIQTEVQGCDISEVQEEQFLEKITRL"

     misc_feature    4..399
                     /locus_tag="SAMD00019534_065910"
                     /note="Cofilin, Destrin, and related actin depolymerizing
                     factors; Region: ADF_cofilin_like; cd11286"
                     /db_xref="CDD:200442"
     misc_feature    4..9
                     /locus_tag="SAMD00019534_065910"
                     /note="putative G-actin interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:200442"
     misc_feature    order(232..234,235..237,277..279,358..360,367..369)
                     /locus_tag="SAMD00019534_065910"
                     /note="putative F-actin interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:200442"
ORIGIN      

tcaactggagtcaaacttgcaaacaattgtatggagattttcgatcagatgaagattcgtcgtcaatatggaatagtcttttataagttgaacgatgacaatactcagattgtggtcgagaagactttaccatatggatcaccattcactactttcctcaccgagctacctcccactgaatgtagatacgtcttagttgactttgcctacaccgaagagtcaacctccaagaagagattggtgttcgtctcatggtgtccaggtacatcaagtattagaagtagaatgatatatactgcttcaaaggatgcacttcgcaaggcattggttggtatccaaactgaggtccaaggttgtgatatatctgaggtccaagaggaacaattccttgagaagatcacgaggttgtag

//