2025-09-18 01:22:38, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_012898411 411 bp mRNA linear INV 15-JUN-2015 DEFINITION Acytostelium subglobosum LB1 hypothetical protein partial mRNA. ACCESSION XM_012898411 VERSION XM_012898411.1 DBLINK BioProject: PRJNA280978 BioSample: SAMD00019534 KEYWORDS RefSeq. SOURCE Acytostelium subglobosum LB1 ORGANISM Acytostelium subglobosum LB1 Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia; Acytosteliales; Acytosteliaceae; Acytostelium. REFERENCE 1 AUTHORS Urushihara,H., Kuwayama,H., Fukuhara,K., Ithoh,T., Kagoshima,H., Shin-I,T., Ohishi,K., Taniguchi,T., Noguchi,H., Kuroki,Y., Hata,T., Uchi,K., Mohri,K., Kohara,Y. and Fujiyama,Y. TITLE Comparative genome and transcriptome analyses of the social amoeba Acytostelium subglobosum that accomplishes multicellular development without germ-soma differentiation JOURNAL Unpublished REFERENCE 2 (bases 1 to 411) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-JUN-2015) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 411) AUTHORS Urushihara,H., Itoh,T., Shin-I,T. and Fujiyama,A. CONSRTM Acytostelium Genome Consortium TITLE Direct Submission JOURNAL Submitted (05-SEP-2014) Contact:Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_012236521). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..411 /organism="Acytostelium subglobosum LB1" /mol_type="mRNA" /strain="LB1" /db_xref="taxon:1410327" /note="scaffold: scaffold12" gene <1..>411 /locus_tag="SAMD00019534_065910" /db_xref="GeneID:24521918" CDS <1..411 /locus_tag="SAMD00019534_065910" /note="ADB0002164; ASU06623; homolog of Dictyostelium discoideum cofB" /codon_start=1 /product="hypothetical protein" /protein_id="XP_012753865.1" /db_xref="GeneID:24521918" /translation="
STGVKLANNCMEIFDQMKIRRQYGIVFYKLNDDNTQIVVEKTLPYGSPFTTFLTELPPTECRYVLVDFAYTEESTSKKRLVFVSWCPGTSSIRSRMIYTASKDALRKALVGIQTEVQGCDISEVQEEQFLEKITRL"
misc_feature 4..399 /locus_tag="SAMD00019534_065910" /note="Cofilin, Destrin, and related actin depolymerizing factors; Region: ADF_cofilin_like; cd11286" /db_xref="CDD:200442" misc_feature 4..9 /locus_tag="SAMD00019534_065910" /note="putative G-actin interface [polypeptide binding]; other site" /db_xref="CDD:200442" misc_feature order(232..234,235..237,277..279,358..360,367..369) /locus_tag="SAMD00019534_065910" /note="putative F-actin interface [polypeptide binding]; other site" /db_xref="CDD:200442" ORIGIN
tcaactggagtcaaacttgcaaacaattgtatggagattttcgatcagatgaagattcgtcgtcaatatggaatagtcttttataagttgaacgatgacaatactcagattgtggtcgagaagactttaccatatggatcaccattcactactttcctcaccgagctacctcccactgaatgtagatacgtcttagttgactttgcctacaccgaagagtcaacctccaagaagagattggtgttcgtctcatggtgtccaggtacatcaagtattagaagtagaatgatatatactgcttcaaaggatgcacttcgcaaggcattggttggtatccaaactgaggtccaaggttgtgatatatctgaggtccaagaggaacaattccttgagaagatcacgaggttgtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]