LOCUS       XM_012897535             297 bp    mRNA    linear   INV 15-JUN-2015
DEFINITION  Acytostelium subglobosum LB1 hypothetical protein partial mRNA.
ACCESSION   XM_012897535
VERSION     XM_012897535.1
DBLINK      BioProject: PRJNA280978
            BioSample: SAMD00019534
KEYWORDS    RefSeq.
SOURCE      Acytostelium subglobosum LB1
  ORGANISM  Acytostelium subglobosum LB1
            Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia;
            Acytosteliales; Acytosteliaceae; Acytostelium.
REFERENCE   1
  AUTHORS   Urushihara,H., Kuwayama,H., Fukuhara,K., Ithoh,T., Kagoshima,H.,
            Shin-I,T., Ohishi,K., Taniguchi,T., Noguchi,H., Kuroki,Y., Hata,T.,
            Uchi,K., Mohri,K., Kohara,Y. and Fujiyama,Y.
  TITLE     Comparative genome and transcriptome analyses of the social amoeba
            Acytostelium subglobosum that accomplishes multicellular
            development without germ-soma differentiation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 297)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2015) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 297)
  AUTHORS   Urushihara,H., Itoh,T., Shin-I,T. and Fujiyama,A.
  CONSRTM   Acytostelium Genome Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (05-SEP-2014) Contact:Hideko Urushihara University of
            Tsukuba, Faculty of Life and Environmental Sciences; Tennodai
            1-1-1, Tsukuba, Ibaraki 305-8572, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_012236519).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..297
                     /organism="Acytostelium subglobosum LB1"
                     /mol_type="mRNA"
                     /strain="LB1"
                     /db_xref="taxon:1410327"
                     /note="scaffold: scaffold14"
     gene            <1..>297
                     /locus_tag="SAMD00019534_071280"
                     /db_xref="GeneID:24522455"
     CDS             <1..>297
                     /locus_tag="SAMD00019534_071280"
                     /note="ADB0001979;
                     ASU07164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_012752989.1"
                     /db_xref="GeneID:24522455"
                     /translation="

GQKRYSKRGEEGDPQVQGWSCQEEIVVQPSFRQRCHRFRKEEGIQHPERSKCLSNIVASRPSLSSPVPLRSLQHWTLDHGGQSVLNSPSVLHVNKQPAF"

ORIGIN      

ggtcagaaacgctactccaaacgtggagaagaaggagacccgcaagtccaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcaccggtttcggaaagaagaagggatacaacacccagaacgttccaaatgtctaagcaacatagtagcgtcgcgtccgtccctcagtagtcccgtgcctctccgctcattgcaacactggacactcgatcacggaggccagtcggtcctcaacagcccgtctgtcctccacgtaaataaacaaccggctttc

//