2024-04-25 21:45:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_012029893 720 bp mRNA linear PRI 30-MAR-2015 DEFINITION PREDICTED: Cercocebus atys claudin 17 (CLDN17), mRNA. ACCESSION XM_012029893 VERSION XM_012029893.1 DBLINK BioProject: PRJNA279144 KEYWORDS RefSeq. SOURCE Cercocebus atys (sooty mangabey) ORGANISM Cercocebus atys Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_012002954.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Cercocebus atys Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..720 /organism="Cercocebus atys" /mol_type="mRNA" /isolate="FAK" /db_xref="taxon:9531" /chromosome="Unknown" /sex="female" /tissue_type="blood" gene 1..720 /gene="CLDN17" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 2 Proteins" /db_xref="GeneID:105571866" CDS 32..706 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_011885283.1" /db_xref="GeneID:105571866" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARARLQCKFYSSLLALPPVLETARALMCVAVALSLIALLLGICGMKQVHCTGSNERTKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAVHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNMKMPSNTSTSYV"
misc_feature 47..577 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
cgaattggactagtcttcaaagtaaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacgcttctgcctcagtggagagtatcggcttttgtcggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggcccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttcttggcatctgtggcatgaagcaggtccactgcacgggctctaatgagaggaccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccaatataatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggaggcggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacatgaaaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]