ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-08 09:46:38, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_011412523 273 bp mRNA linear PLN 29-DEC-2023
DEFINITION Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory
protein (MAA_11608), partial mRNA.
ACCESSION XM_011412523
VERSION XM_011412523.1
DBLINK BioProject: PRJNA245140
BioSample: SAMN02981260
KEYWORDS RefSeq.
SOURCE Metarhizium robertsii ARSEF 23
ORGANISM Metarhizium robertsii ARSEF 23
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae;
Metarhizium.
REFERENCE 1 (bases 1 to 273)
AUTHORS Hu,X., Xiao,G., Zheng,P., Shang,Y., Su,Y., Zhang,X., Liu,X.,
Zhan,S., St Leger,R.J. and Wang,C.
TITLE Trajectory and genomic determinants of fungal-pathogen speciation
and host adaptation
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 111 (47), 16796-16801 (2014)
PUBMED 25368161
REFERENCE 2 (bases 1 to 273)
AUTHORS Gao,Q., Jin,K., Ying,S.H., Zhang,Y., Xiao,G., Shang,Y., Duan,Z.,
Hu,X., Xie,X.Q., Zhou,G., Peng,G., Luo,Z., Huang,W., Wang,B.,
Fang,W., Wang,S., Zhong,Y., Ma,L.J., St Leger,R.J., Zhao,G.P.,
Pei,Y., Feng,M.G., Xia,Y. and Wang,C.
TITLE Genome sequencing and comparative transcriptomics of the model
entomopathogenic fungi Metarhizium anisopliae and M. acridum
JOURNAL PLoS Genet. 7 (1), E1001264 (2011)
PUBMED 21253567
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 273)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 4 (bases 1 to 273)
AUTHORS Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and
Wang,C.
TITLE Direct Submission
JOURNAL Submitted (07-DEC-2013) Institute of Plant Physiology and Ecology,
Shanghai Institutes for Biological Sciences, 300 Fengling Road,
Shanghai, Shanghai 200032, China
REFERENCE 5 (bases 1 to 273)
AUTHORS Gao,Q., Jin,K., Ying,S., Luo,Z., Xiao,G., Duan,Z., Xie,X., Zhou,G.,
Peng,G., Zhang,Y., Shang,Y.F., Huang,W., Wang,B., Wang,S., Fang,W.,
Ma,L.-J., Liu,X., St. Leger,R.J., Pei,Y., Feng,M., Xia,Y. and
Wang,C.
CONSRTM Metarhizium genome sequencing Consortium
TITLE Direct Submission
JOURNAL Submitted (10-MAY-2010) Institute of Plant Physiology and Ecology,
Shanghai Institutes for Biological Sciences, 300 Fenglin Road,
Shanghai, Shanghai 200032, China
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_011942151).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..273
/organism="Metarhizium robertsii ARSEF 23"
/mol_type="mRNA"
/strain="ARSEF 23"
/host="Conoderus sp."
/db_xref="taxon:655844"
/chromosome="Unknown"
/geo_loc_name="USA: North Carolina"
/collection_date="1961"
gene <1..>273
/locus_tag="MAA_11608"
/db_xref="GeneID:23633056"
CDS 1..273
/locus_tag="MAA_11608"
/codon_start=1
/product="Fungal transcriptional regulatory protein"
/protein_id="XP_011410825.1"
/db_xref="GeneID:23633056"
/translation="
MIALKSWKKSERVRWDGNKHSPEETAGLFGLGALSWLNPLSLAGYKKRLALEDLYRLDCNLASEHLQVNHPPVSTVCAVALGNVTVWPER"
misc_feature 46..>174
/locus_tag="MAA_11608"
/note="ABC transporter C family member; Provisional;
Region: PLN03130"
/db_xref="CDD:215595"
ORIGIN
atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]