GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-21 02:00:29, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_011328621             411 bp    mRNA    linear   PLN 02-JAN-2024
DEFINITION  Fusarium graminearum PH-1 uncharacterized protein (FGSG_13090),
            partial mRNA.
ACCESSION   XM_011328621
VERSION     XM_011328621.1
DBLINK      BioProject: PRJNA243
            BioSample: SAMN02953593
KEYWORDS    RefSeq.
SOURCE      Fusarium graminearum PH-1 (Gibberella zeae PH-1)
  ORGANISM  Fusarium graminearum PH-1
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae;
            Fusarium.
REFERENCE   1  (bases 1 to 411)
  AUTHORS   Cuomo,C.A., Guldener,U., Xu,J.R., Trail,F., Turgeon,B.G., Di
            Pietro,A., Walton,J.D., Ma,L.J., Baker,S.E., Rep,M., Adam,G.,
            Antoniw,J., Baldwin,T., Calvo,S., Chang,Y.L., Decaprio,D.,
            Gale,L.R., Gnerre,S., Goswami,R.S., Hammond-Kosack,K., Harris,L.J.,
            Hilburn,K., Kennell,J.C., Kroken,S., Magnuson,J.K., Mannhaupt,G.,
            Mauceli,E., Mewes,H.W., Mitterbauer,R., Muehlbauer,G.,
            Munsterkotter,M., Nelson,D., O'donnell,K., Ouellet,T., Qi,W.,
            Quesneville,H., Roncero,M.I., Seong,K.Y., Tetko,I.V., Urban,M.,
            Waalwijk,C., Ward,T.J., Yao,J., Birren,B.W. and Kistler,H.C.
  TITLE     The Fusarium graminearum genome reveals a link between localized
            polymorphism and pathogen specialization
  JOURNAL   Science 317 (5843), 1400-1402 (2007)
   PUBMED   17823352
REFERENCE   2  (bases 1 to 411)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 411)
  AUTHORS   Birren,B., Lander,E., Galagan,J., Nusbaum,C., Devon,K., Ma,L.-J.,
            Jaffe,D., Butler,J., Alvarez,P., Gnerre,S., Grabherr,M., Kleber,M.,
            Mauceli,E., Brockman,W., MacCallum,I.A., Young,S., LaButti,K.,
            DeCaprio,D., Crawford,M., Koehrsen,M., Engels,R., Montgomery,P.,
            Pearson,M., Howarth,C., Larson,L., White,J., O'Leary,S., Kodira,C.,
            Zeng,Q., Yandava,C., Alvarado,L., Kistler,C., Xu,J.-R. and Trail,F.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     Direct Submission
  JOURNAL   Submitted (08-NOV-2008) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_026477).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..411
                     /organism="Fusarium graminearum PH-1"
                     /mol_type="mRNA"
                     /strain="PH-1; NRRL 31084"
                     /db_xref="taxon:229533"
                     /chromosome="4"
     gene            <1..>411
                     /locus_tag="FGSG_13090"
                     /db_xref="GeneID:23559897"
     CDS             1..411
                     /locus_tag="FGSG_13090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_011326923.1"
                     /db_xref="GeneID:23559897"
                     /translation="
MSHDGFCDSMQAGHAVLSGCFASAASLSGLVTEQQGNGSIFMTIPRNIVISIYIGCKNKWAALKTWTCCQVDEKWIRGSTATKSRRRPVGTGPQLEGYRTKTWTQTMNPDLDLGSRLIPEACVPGCRSGRITPATR"
ORIGIN      
atgtctcatgatggattctgtgacagcatgcaggcaggacacgccgtactgtcgggttgcttcgcttcagccgcttcgctttcaggtctggtgaccgaacagcaaggtaatggctccatattcatgaccatcccacgaaacatcgttatcagtatctatatcggttgcaagaacaaatgggcagccttaaagacttggacgtgttgtcaagtcgatgagaaatggattcgggggtcgactgccaccaaatctcgccgccggccggttgggactggtccccagctggaaggataccgtaccaagacctggacccagaccatgaacccggacctggacctgggctcgaggctaataccggaagcgtgcgttcctggttgtaggtcaggtcggatcactcccgcgacgcgatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]