ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-21 23:41:20, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_011328621 411 bp mRNA linear PLN 02-JAN-2024
DEFINITION Fusarium graminearum PH-1 uncharacterized protein (FGSG_13090),
partial mRNA.
ACCESSION XM_011328621
VERSION XM_011328621.1
DBLINK BioProject: PRJNA243
BioSample: SAMN02953593
KEYWORDS RefSeq.
SOURCE Fusarium graminearum PH-1 (Gibberella zeae PH-1)
ORGANISM Fusarium graminearum PH-1
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae;
Fusarium.
REFERENCE 1 (bases 1 to 411)
AUTHORS Cuomo,C.A., Guldener,U., Xu,J.R., Trail,F., Turgeon,B.G., Di
Pietro,A., Walton,J.D., Ma,L.J., Baker,S.E., Rep,M., Adam,G.,
Antoniw,J., Baldwin,T., Calvo,S., Chang,Y.L., Decaprio,D.,
Gale,L.R., Gnerre,S., Goswami,R.S., Hammond-Kosack,K., Harris,L.J.,
Hilburn,K., Kennell,J.C., Kroken,S., Magnuson,J.K., Mannhaupt,G.,
Mauceli,E., Mewes,H.W., Mitterbauer,R., Muehlbauer,G.,
Munsterkotter,M., Nelson,D., O'donnell,K., Ouellet,T., Qi,W.,
Quesneville,H., Roncero,M.I., Seong,K.Y., Tetko,I.V., Urban,M.,
Waalwijk,C., Ward,T.J., Yao,J., Birren,B.W. and Kistler,H.C.
TITLE The Fusarium graminearum genome reveals a link between localized
polymorphism and pathogen specialization
JOURNAL Science 317 (5843), 1400-1402 (2007)
PUBMED 17823352
REFERENCE 2 (bases 1 to 411)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 411)
AUTHORS Birren,B., Lander,E., Galagan,J., Nusbaum,C., Devon,K., Ma,L.-J.,
Jaffe,D., Butler,J., Alvarez,P., Gnerre,S., Grabherr,M., Kleber,M.,
Mauceli,E., Brockman,W., MacCallum,I.A., Young,S., LaButti,K.,
DeCaprio,D., Crawford,M., Koehrsen,M., Engels,R., Montgomery,P.,
Pearson,M., Howarth,C., Larson,L., White,J., O'Leary,S., Kodira,C.,
Zeng,Q., Yandava,C., Alvarado,L., Kistler,C., Xu,J.-R. and Trail,F.
CONSRTM The Broad Institute Genome Sequencing Platform
TITLE Direct Submission
JOURNAL Submitted (08-NOV-2008) Broad Institute of MIT and Harvard, 7
Cambridge Center, Cambridge, MA 02142, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NC_026477).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..411
/organism="Fusarium graminearum PH-1"
/mol_type="mRNA"
/strain="PH-1; NRRL 31084"
/db_xref="taxon:229533"
/chromosome="4"
gene <1..>411
/locus_tag="FGSG_13090"
/db_xref="GeneID:23559897"
CDS 1..411
/locus_tag="FGSG_13090"
/codon_start=1
/product="hypothetical protein"
/protein_id="XP_011326923.1"
/db_xref="GeneID:23559897"
/translation="
MSHDGFCDSMQAGHAVLSGCFASAASLSGLVTEQQGNGSIFMTIPRNIVISIYIGCKNKWAALKTWTCCQVDEKWIRGSTATKSRRRPVGTGPQLEGYRTKTWTQTMNPDLDLGSRLIPEACVPGCRSGRITPATR"
ORIGIN
atgtctcatgatggattctgtgacagcatgcaggcaggacacgccgtactgtcgggttgcttcgcttcagccgcttcgctttcaggtctggtgaccgaacagcaaggtaatggctccatattcatgaccatcccacgaaacatcgttatcagtatctatatcggttgcaagaacaaatgggcagccttaaagacttggacgtgttgtcaagtcgatgagaaatggattcgggggtcgactgccaccaaatctcgccgccggccggttgggactggtccccagctggaaggataccgtaccaagacctggacccagaccatgaacccggacctggacctgggctcgaggctaataccggaagcgtgcgttcctggttgtaggtcaggtcggatcactcccgcgacgcgatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]