2024-05-20 07:44:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_010832701 280 bp mRNA linear MAM 31-DEC-2014 DEFINITION PREDICTED: Bison bison bison plasma membrane calcium-transporting ATPase 3-like (LOC104983269), partial mRNA. ACCESSION XM_010832701 VERSION XM_010832701.1 DBLINK BioProject: PRJNA266339 KEYWORDS RefSeq. SOURCE Bison bison bison ORGANISM Bison bison bison Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bison. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_011472491.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Bison bison bison Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..280 /organism="Bison bison bison" /mol_type="mRNA" /isolate="TAMUID 2011002044" /sub_species="bison" /db_xref="taxon:43346" /chromosome="Unknown" /sex="male" /tissue_type="blood" gene <1..>280 /gene="LOC104983269" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:104983269" CDS <1..>280 /gene="LOC104983269" /codon_start=1 /product="plasma membrane calcium-transporting ATPase 3-like" /protein_id="XP_010831003.1" /db_xref="GeneID:104983269" /translation="
KMMRDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEVPAPSALTPKILDILVHAISINSAYTTKILPPEKEGALPRQV"
misc_feature <1..>135 /gene="LOC104983269" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" misc_feature 79..93 /gene="LOC104983269" /note="HAD signature motif I; other site" /db_xref="CDD:319763" ORIGIN
aaaatgatgagggacaacaacctggtccgccacctggatgcctgcgagaccatgggcaatgccacagccatctgttctgacaagacgggcacactcaccaccaaccgcatgaccgtggtgcagtcctaccttggggacacccactacaaagaggttccagcccccagtgccctgacccccaagatcctcgacatcctggtccatgccatctccatcaacagtgcctacaccaccaaaatactacctccagagaaggaaggcgccctcccacgccaagtgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]