LOCUS       XM_010364917             983 bp    mRNA    linear   PRI 25-SEP-2019
DEFINITION  PREDICTED: Rhinopithecus roxellana claudin 17 (CLDN17), mRNA.
ACCESSION   XM_010364917
VERSION     XM_010364917.2
DBLINK      BioProject: PRJNA565017
KEYWORDS    RefSeq.
SOURCE      Rhinopithecus roxellana (golden snub-nosed monkey)
  ORGANISM  Rhinopithecus roxellana
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_044561.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 25, 2019 this sequence version replaced XM_010364917.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Rhinopithecus roxellana Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..983
                     /organism="Rhinopithecus roxellana"
                     /mol_type="mRNA"
                     /isolate="Shanxi Qingling"
                     /db_xref="taxon:61622"
                     /chromosome="13"
                     /sex="male"
                     /tissue_type="heart"
                     /dev_stage="adult"
     gene            1..983
                     /gene="CLDN17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 mRNAs, 2 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 1 sample with support for all
                     annotated introns"
                     /db_xref="GeneID:104663641"
     CDS             195..869
                     /gene="CLDN17"
                     /codon_start=1
                     /product="claudin-17"
                     /protein_id="XP_010363219.2"
                     /db_xref="GeneID:104663641"
                     /translation="

MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRLSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAVHIGQKRELGVALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNVTMPSNTSTSYV"

     misc_feature    210..740
                     /gene="CLDN17"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      

gcaacatgcatttacaacaggtacttctagttaggccaagttcagtcacagccactgatttggactaaaatgatatgggcagcagccaaggagaacatcatcaaagacttctctagactcaagagccttccacgttctacatcttgagcatcttctaccactctgaattggactagtcttcaaagtaaaagacaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacgcttctgcctcagtggagactatccgcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcacttatgtgtgtggctgttgctctttccttgatcgccctacttattggcatctgtggcatgaagcaggtccagtgcacaggctctaatgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccagtgagctggacagccaatataatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagtagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacgtgacaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggctccaagtgtggactatggtcaatgtttgttataaagtcctgctagaaactatacaactgaaaatcatcctgaaatgggggcttctcagcagaatccaagg

//