2024-05-20 07:08:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_010221238 842 bp mRNA linear VRT 13-NOV-2014 DEFINITION PREDICTED: Tinamus guttatus ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (ST6GALNAC5), mRNA. ACCESSION XM_010221238 VERSION XM_010221238.1 DBLINK BioProject: PRJNA265201 KEYWORDS RefSeq. SOURCE Tinamus guttatus (white-throated tinamou) ORGANISM Tinamus guttatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_010586134.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Tinamus guttatus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..842 /organism="Tinamus guttatus" /mol_type="mRNA" /isolate="BGI_N309" /db_xref="taxon:94827" /chromosome="Unknown" /sex="female" /country="Peru" gene 1..842 /gene="ST6GALNAC5" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 EST, 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:104573997" CDS 83..823 /gene="ST6GALNAC5" /codon_start=1 /product="alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5" /protein_id="XP_010219540.1" /db_xref="GeneID:104573997" /translation="
MHCKSCALVTSSGHLLGSKQGDKIDQTECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKAYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPLGPDECTMYLSHERGRKGSHHRFITEKRVFENWARTFNIHFFQPDWKPEPLTVNHSEVKPVV"
misc_feature 86..631 /gene="ST6GALNAC5" /note="Glycosyltransferase family 29 (sialyltransferase); Region: Glyco_transf_29; pfam00777" /db_xref="CDD:425864" ORIGIN
cggccagcagcgcccggcgccgcccggcgggaccggcctcctcgagggctacatcagcgtcctggagcacaagcctttaaagatgcattgcaagagttgtgcattggtcaccagctctggacaccttctgggaagtaaacaaggtgacaaaatcgaccagacagagtgcgtaatacgaatgaatgatgcacctacccgaggttatggaaaagatgtgggcaacaaaacaagccttcgagtcattgcacactccagcatccagaggattttaagaaatcgcaacgaactcttaaatatgagccatggagctgtgtttatcttctggggtcctagcagctacatgaggagagatggaaaaggcttggtgtataataacctgcaactgatgaatcagatactgcctcaattaaaagcatatatgatttctcgccacaagatgcttcaatttgatgacttgttcaaacgggaaactgggaaagacaggaagatatccaacacttggcttagcacgggctggttcacaatgactatcgcattagagctctgtgacaggataaatgtttatggcatggtgccaccggatttctgcagggatcctaatcatctttcagtaccttatcattactacgaacctctgggacctgacgagtgcacaatgtacctttcccacgagcggggccgcaagggcagccatcatcgcttcatcacagagaaacgagtctttgagaactgggcacggacattcaatattcactttttccaaccagactggaaaccagaaccacttactgtgaatcactctgaggttaaaccggtggtctgagggatcaacaccaaagact
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]