2024-05-20 10:06:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_010185124 744 bp mRNA linear VRT 06-NOV-2014 DEFINITION PREDICTED: Mesitornis unicolor ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (ST6GALNAC5), mRNA. ACCESSION XM_010185124 VERSION XM_010185124.1 DBLINK BioProject: PRJNA265381 KEYWORDS RefSeq. SOURCE Mesitornis unicolor (brown roatelo) ORGANISM Mesitornis unicolor Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Gruiformes; Mesitornithidae; Mesitornis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_010186331.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Mesitornis unicolor Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..744 /organism="Mesitornis unicolor" /mol_type="mRNA" /isolate="BGI_N332" /db_xref="taxon:54374" /chromosome="Unknown" /sex="female" /country="Madagascar" gene 1..744 /gene="ST6GALNAC5" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 EST, 4 Proteins" /db_xref="GeneID:104541143" CDS 4..744 /gene="ST6GALNAC5" /codon_start=1 /product="alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5" /protein_id="XP_010183426.1" /db_xref="GeneID:104541143" /translation="
MHCKSCALVTSSGHLLGSKQGDRIDETECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKVYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPLGPDECTMYISHERGRKGSHHRFITEKRVFENWARTFNIHFFQPDWKPEPLTVNHPQVKAVA"
misc_feature 7..552 /gene="ST6GALNAC5" /note="Glycosyltransferase family 29 (sialyltransferase); Region: Glyco_transf_29; pfam00777" /db_xref="CDD:425864" ORIGIN
aaaatgcactgcaagagttgtgctttggtaaccagctctggacacctcctgggaagtaaacaaggtgacagaatcgacgagacggagtgcgtaatacgaatgaatgatgcacccactcggggttatggaaaagatgttggcaacaaaacgagccttcgagtcattgcacactccagcattcagaggattttgcgaaatcgtaatgaactcttaaatatgagccacggtgctgtgttcatcttctggggtcctagcagctacatgaggagagatggtaaaggcctggtgtataataacctgcagctgatgaatcagatactgcctcaattaaaagtatatatgatttctcgccacaagatgctgcaatttgatgacctttttaaacgggaaaccgggaaagacaggaagatatccaacacttggcttagcacgggctggttcacaatgactatcgcgttagagctctgtgacaggataaatgtgtatggcatggtgccaccggatttctgcagggatcctaatcatctgtcagtaccttatcattattatgaacctctgggacccgacgagtgcacaatgtacatctcacacgagcggggacggaagggcagtcaccatcgcttcatcacagagaaacgagtgttcgagaactgggcacggacattcaacattcactttttccaaccggactggaaaccggagcccctcactgtaaaccacccccaggtcaaagcggtggcctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]