LOCUS       XM_010078668             547 bp    mRNA    linear   VRT 06-NOV-2014
DEFINITION  PREDICTED: Pterocles gutturalis transmembrane protein 139-like
            (LOC104465571), partial mRNA.
ACCESSION   XM_010078668
VERSION     XM_010078668.1
DBLINK      BioProject: PRJNA265368
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Pterocles gutturalis (yellow-throated sandgrouse)
  ORGANISM  Pterocles gutturalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Ciconiiformes; Pteroclidae;
            Pterocles.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_010125685.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Pterocles gutturalis Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio            :: 14% of CDS bases
            internal stop codons :: corrected 1 genomic stop codon
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..547
                     /organism="Pterocles gutturalis"
                     /mol_type="mRNA"
                     /isolate="BGI_N339"
                     /db_xref="taxon:240206"
                     /chromosome="Unknown"
                     /sex="male"
                     /country="Tanzania"
     gene            <1..547
                     /gene="LOC104465571"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:104465571"
     CDS             <1..547
                     /gene="LOC104465571"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 1 base at 1
                     genomic stop codon"
                     /codon_start=2
                     /transl_except=(pos:407..409,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: transmembrane protein
                     139-like"
                     /protein_id="XP_010076970.1"
                     /db_xref="GeneID:104465571"
                     /translation="

VNAAYEAPTYEEVMTMSVPAIWTIASNPGLVPSPMNEPPPYNVVIESSAQEEIVVEALRVSVASDTRHTSETDTGSRMQLQLVLPPRLQRFVSDIHEVKGVEDRFEPPEPLTPPPAYESAINDEVFEDTFQPSTLXLISTSMNAEPNPHSNTGCSSREGERSEIFHAQNCKSLSHHSLNQR"

ORIGIN      

ggtgaacgctgcctacgaagcacctacctatgaggaagtgatgaccatgtcagttccagcaatttggacaattgcatccaatccaggcttagtgccttcaccaatgaatgagcctcctccttacaacgtagttattgaatcatctgcccaagaagagattgtggtggaggctctcagggtgtcagtggcgtcagacacaaggcacacctctgagacagacacaggctccaggatgcagttgcagctggtgcttccccctagactgcagcggtttgtttcagacatccatgaagtgaaaggtgttgaagacaggtttgagccaccggagccactcactccaccacctgcttatgaaagtgccatcaacgatgaggtctttgaagatactttccagccctccacattatgattaatttcaacttccatgaatgcagaaccaaaccctcactccaatacaggatgctcctcaagggaaggtgaaagatctgagatttttcatgcccaaaactgtaaaagtttgtctcaccattctttgaaccagagatga

//