ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-25 21:57:01, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_010078668 547 bp mRNA linear VRT 06-NOV-2014
DEFINITION PREDICTED: Pterocles gutturalis transmembrane protein 139-like
(LOC104465571), partial mRNA.
ACCESSION XM_010078668
VERSION XM_010078668.1
DBLINK BioProject: PRJNA265368
KEYWORDS RefSeq; corrected model; includes ab initio.
SOURCE Pterocles gutturalis (yellow-throated sandgrouse)
ORGANISM Pterocles gutturalis
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Neoaves; Columbimorphae;
Pterocliformes; Pteroclidae; Pterocles.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_010125685.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Pterocles gutturalis Annotation
Release 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.1
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 14% of CDS bases
internal stop codons :: corrected 1 genomic stop codon
##RefSeq-Attributes-END##
COMPLETENESS: incomplete on the 5' end.
FEATURES Location/Qualifiers
source 1..547
/organism="Pterocles gutturalis"
/mol_type="mRNA"
/isolate="BGI_N339"
/db_xref="taxon:240206"
/chromosome="Unknown"
/sex="male"
/geo_loc_name="Tanzania"
gene <1..547
/gene="LOC104465571"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 3 Proteins"
/db_xref="GeneID:104465571"
CDS <1..547
/gene="LOC104465571"
/note="The sequence of the model RefSeq protein was
modified relative to its source genomic sequence to
represent the inferred CDS: substituted 1 base at 1
genomic stop codon"
/codon_start=2
/transl_except=(pos:407..409,aa:OTHER)
/product="LOW QUALITY PROTEIN: transmembrane protein
139-like"
/protein_id="XP_010076970.1"
/db_xref="GeneID:104465571"
/translation="
VNAAYEAPTYEEVMTMSVPAIWTIASNPGLVPSPMNEPPPYNVVIESSAQEEIVVEALRVSVASDTRHTSETDTGSRMQLQLVLPPRLQRFVSDIHEVKGVEDRFEPPEPLTPPPAYESAINDEVFEDTFQPSTLXLISTSMNAEPNPHSNTGCSSREGERSEIFHAQNCKSLSHHSLNQR"
ORIGIN
ggtgaacgctgcctacgaagcacctacctatgaggaagtgatgaccatgtcagttccagcaatttggacaattgcatccaatccaggcttagtgccttcaccaatgaatgagcctcctccttacaacgtagttattgaatcatctgcccaagaagagattgtggtggaggctctcagggtgtcagtggcgtcagacacaaggcacacctctgagacagacacaggctccaggatgcagttgcagctggtgcttccccctagactgcagcggtttgtttcagacatccatgaagtgaaaggtgttgaagacaggtttgagccaccggagccactcactccaccacctgcttatgaaagtgccatcaacgatgaggtctttgaagatactttccagccctccacattatgattaatttcaacttccatgaatgcagaaccaaaccctcactccaatacaggatgctcctcaagggaaggtgaaagatctgagatttttcatgcccaaaactgtaaaagtttgtctcaccattctttgaaccagagatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]