GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 10:50:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_009954309             449 bp    mRNA    linear   VRT 28-OCT-2014
DEFINITION  PREDICTED: Leptosomus discolor ST6
            (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,
            3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
            (ST6GALNAC5), partial mRNA.
ACCESSION   XM_009954309
VERSION     XM_009954309.1
DBLINK      BioProject: PRJNA263616
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Leptosomus discolor (cuckoo roller)
  ORGANISM  Leptosomus discolor
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Coraciiformes; Leptosomidae;
            Leptosomus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_009871401.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Leptosomus discolor Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..449
                     /organism="Leptosomus discolor"
                     /mol_type="mRNA"
                     /isolate="BGI_N330"
                     /db_xref="taxon:188344"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..>449
                     /gene="ST6GALNAC5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 7 Proteins"
                     /db_xref="GeneID:104348920"
     CDS             1..>449
                     /gene="ST6GALNAC5"
                     /codon_start=1
                     /product="alpha-N-acetylgalactosaminide
                     alpha-2,6-sialyltransferase 5"
                     /protein_id="XP_009952611.1"
                     /db_xref="GeneID:104348920"
                     /translation="
MSAANFEVCMSLQPLKMHCKSCALVTSSGHLLGSKQGDRIDETECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKAYMISRHKMLQFDDLFKRETGKD"
     misc_feature    31..>288
                     /gene="ST6GALNAC5"
                     /note="Glycosyltransferase family 29 (sialyltransferase);
                     Region: Glyco_transf_29; pfam00777"
                     /db_xref="CDD:425864"
ORIGIN      
atgtctgcagctaattttgaagtgtgtatgtctttgcagcctttaaaaatgcactgcaagagttgtgcgttggtaaccagctctggacaccttctgggaagcaaacaaggcgacagaatcgatgagacggagtgtgtaatacgaatgaatgacgcacctacccgaggttacggaaaagatgttggaaacaaaacgagcctccgagtcattgcacactccagcattcagaggattttgcgaaatcgcaacgaactcttaaatatgagccacggtgccgtgtttatcttctggggtccgagcagctacatgaggagagatggtaaaggcctggtgtacaataacctgcagctgatgaatcagatactgcctcagttaaaagcatatatgatttctcgccacaagatgcttcagtttgatgacctttttaaacgggaaactgggaaggacag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]