2024-05-18 17:07:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009548262 321 bp mRNA linear PLN 02-JAN-2024 DEFINITION Heterobasidion irregulare TC 32-1 uncharacterized protein (HETIRDRAFT_451633), partial mRNA. ACCESSION XM_009548262 VERSION XM_009548262.1 DBLINK BioProject: PRJNA245138 BioSample: SAMN02743865 KEYWORDS RefSeq. SOURCE Heterobasidion irregulare TC 32-1 ORGANISM Heterobasidion irregulare TC 32-1 Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Russulales; Bondarzewiaceae; Heterobasidion; Heterobasidion annosum species complex. REFERENCE 1 (bases 1 to 321) AUTHORS Olson,A., Aerts,A., Asiegbu,F., Belbahri,L., Bouzid,O., Broberg,A., Canback,B., Coutinho,P.M., Cullen,D., Dalman,K., Deflorio,G., van Diepen,L.T., Dunand,C., Duplessis,S., Durling,M., Gonthier,P., Grimwood,J., Fossdal,C.G., Hansson,D., Henrissat,B., Hietala,A., Himmelstrand,K., Hoffmeister,D., Hogberg,N., James,T.Y., Karlsson,M., Kohler,A., Kues,U., Lee,Y.H., Lin,Y.C., Lind,M., Lindquist,E., Lombard,V., Lucas,S., Lunden,K., Morin,E., Murat,C., Park,J., Raffaello,T., Rouze,P., Salamov,A., Schmutz,J., Solheim,H., Stahlberg,J., Velez,H., de Vries,R.P., Wiebenga,A., Woodward,S., Yakovlev,I., Garbelotto,M., Martin,F., Grigoriev,I.V. and Stenlid,J. TITLE Insight into trade-off between wood decay and parasitism from the genome of a fungal forest pathogen JOURNAL New Phytol. 194 (4), 1001-1013 (2012) PUBMED 22463738 REFERENCE 2 (bases 1 to 321) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 321) AUTHORS Ohm,R., Aerts,A., Salamov,A., Schmutz,J., Grimwood,J., Lindquist,E., Lucas,S., Pitluck,S., Olson,A., Asiegbu,F., Belbahri,L., Bouzid,O., Broberg,A., Canback,B., Coutinho,P.M., Cullen,D., Dalman,K., Deflorio,G., van Diepen,L.T.A., Dunand,C., Duplessis,S., Durling,M., Gonthier,P., Fossdal,C.G., Hansson,D., Henrissat,B., Hietala,A., Himmelstrand,K., Hoffmeister,D., Hogberg,N., James,T.Y., Karlsson,M., Lind,M., Kohler,A., Kues,U., Lee,Y.-H., Lin,Y.-C., Lombard,V., Lunden,K., Morin,E., Murat,C., Park,J., Raffaello,T., Rouze,P., Solheim,H., Stahlberg,J., Velez,H., Velez,H., Wiebenga,A., Woodward,S., Yakovlev,I., Garbelotto,M., Martin,F., Stenlid,J. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (21-MAY-2012) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_009258201). ##Metadata-START## Organism Display Name :: Heterobasidion irregulare TC 32-1 GOLD Stamp ID :: Gi01578 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..321 /organism="Heterobasidion irregulare TC 32-1" /mol_type="mRNA" /strain="TC 32-1" /host="Pinus resinosa" /db_xref="taxon:747525" /chromosome="Unknown" /dev_stage="basidiospore" /country="USA: Woodstock, Vermont" /collection_date="1979" gene <1..>321 /locus_tag="HETIRDRAFT_451633" /db_xref="GeneID:20676178" CDS 1..321 /locus_tag="HETIRDRAFT_451633" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_009546557.1" /db_xref="GeneID:20676178" /db_xref="JGIDB:Hetan2_451633" /translation="
MAPPTMPARGDRSAPTFDPSRPRTLRRYFADLDFHFVRSAVNSDLERKRHACRFADLDTSDLWESLPTFSDHAKTYQDFCDSVYKLYPAGSALAHWGIWASITEDF"
ORIGIN
atggcccccccgaccatgccagctcgaggcgatcgatccgcacccactttcgaccccagccgaccacgcactcttcgccgatactttgcagaccttgactttcactttgttcgttcggcagtcaacagcgacttggagcggaagagacacgcctgccgattcgccgatcttgacacctccgacctctgggagtccctgccgaccttttcggaccacgcgaagacataccaggacttctgtgactctgtgtacaagctttatcctgccggatcggcattggctcactgggggatctgggcgtctattaccgaagatttctag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]