LOCUS       XM_009546745             321 bp    mRNA    linear   PLN 02-JAN-2024
DEFINITION  Heterobasidion irregulare TC 32-1 uncharacterized protein
            (HETIRDRAFT_450487), partial mRNA.
ACCESSION   XM_009546745
VERSION     XM_009546745.1
DBLINK      BioProject: PRJNA245138
            BioSample: SAMN02743865
KEYWORDS    RefSeq.
SOURCE      Heterobasidion irregulare TC 32-1
  ORGANISM  Heterobasidion irregulare TC 32-1
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Russulales; Bondarzewiaceae; Heterobasidion;
            Heterobasidion annosum species complex.
REFERENCE   1  (bases 1 to 321)
  AUTHORS   Olson,A., Aerts,A., Asiegbu,F., Belbahri,L., Bouzid,O., Broberg,A.,
            Canback,B., Coutinho,P.M., Cullen,D., Dalman,K., Deflorio,G., van
            Diepen,L.T., Dunand,C., Duplessis,S., Durling,M., Gonthier,P.,
            Grimwood,J., Fossdal,C.G., Hansson,D., Henrissat,B., Hietala,A.,
            Himmelstrand,K., Hoffmeister,D., Hogberg,N., James,T.Y.,
            Karlsson,M., Kohler,A., Kues,U., Lee,Y.H., Lin,Y.C., Lind,M.,
            Lindquist,E., Lombard,V., Lucas,S., Lunden,K., Morin,E., Murat,C.,
            Park,J., Raffaello,T., Rouze,P., Salamov,A., Schmutz,J.,
            Solheim,H., Stahlberg,J., Velez,H., de Vries,R.P., Wiebenga,A.,
            Woodward,S., Yakovlev,I., Garbelotto,M., Martin,F., Grigoriev,I.V.
            and Stenlid,J.
  TITLE     Insight into trade-off between wood decay and parasitism from the
            genome of a fungal forest pathogen
  JOURNAL   New Phytol. 194 (4), 1001-1013 (2012)
   PUBMED   22463738
REFERENCE   2  (bases 1 to 321)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 321)
  AUTHORS   Ohm,R., Aerts,A., Salamov,A., Schmutz,J., Grimwood,J.,
            Lindquist,E., Lucas,S., Pitluck,S., Olson,A., Asiegbu,F.,
            Belbahri,L., Bouzid,O., Broberg,A., Canback,B., Coutinho,P.M.,
            Cullen,D., Dalman,K., Deflorio,G., van Diepen,L.T.A., Dunand,C.,
            Duplessis,S., Durling,M., Gonthier,P., Fossdal,C.G., Hansson,D.,
            Henrissat,B., Hietala,A., Himmelstrand,K., Hoffmeister,D.,
            Hogberg,N., James,T.Y., Karlsson,M., Lind,M., Kohler,A., Kues,U.,
            Lee,Y.-H., Lin,Y.-C., Lombard,V., Lunden,K., Morin,E., Murat,C.,
            Park,J., Raffaello,T., Rouze,P., Solheim,H., Stahlberg,J.,
            Velez,H., Velez,H., Wiebenga,A., Woodward,S., Yakovlev,I.,
            Garbelotto,M., Martin,F., Stenlid,J. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_009258200).
            
            ##Metadata-START##
            Organism Display Name :: Heterobasidion irregulare TC 32-1
            GOLD Stamp ID         :: Gi01578
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..321
                     /organism="Heterobasidion irregulare TC 32-1"
                     /mol_type="mRNA"
                     /strain="TC 32-1"
                     /host="Pinus resinosa"
                     /db_xref="taxon:747525"
                     /chromosome="Unknown"
                     /dev_stage="basidiospore"
                     /country="USA: Woodstock, Vermont"
                     /collection_date="1979"
     gene            <1..>321
                     /locus_tag="HETIRDRAFT_450487"
                     /db_xref="GeneID:20676052"
     CDS             1..321
                     /locus_tag="HETIRDRAFT_450487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_009545040.1"
                     /db_xref="GeneID:20676052"
                     /db_xref="JGIDB:Hetan2_450487"
                     /translation="

MAPPTMPARGDRSAPTFDPSRPRTLRRYFADLDFHFVRSAVNSDLERKRHACRFADLDTSDLWESLPTFSDHAKTYQDFCDSVYKLYPAGSALAHWGIWASITEDF"

ORIGIN      

atggcccccccgaccatgccagctcgaggcgatcgatccgcacccactttcgaccccagccgaccacgcactcttcgccgatactttgcagaccttgactttcactttgttcgttcggcagtcaacagcgacttggagcggaagagacacgcctgccgattcgccgatcttgacacctccgacctctgggagtccctgccgaccttttcggaccacgcgaagacataccaggacttctgtgactctgtgtacaagctttatcctgccggatcggcattggctcactgggggatctgggcgtctattaccgaagatttctag

//