GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 00:18:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_009330145            1298 bp    mRNA    linear   VRT 26-SEP-2014
DEFINITION  PREDICTED: Pygoscelis adeliae homeobox B8 (HOXB8), transcript
            variant X1, mRNA.
ACCESSION   XM_009330145
VERSION     XM_009330145.1
DBLINK      BioProject: PRJNA261076
KEYWORDS    RefSeq.
SOURCE      Pygoscelis adeliae (Adelie penguin)
  ORGANISM  Pygoscelis adeliae
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Sphenisciformes; Spheniscidae;
            Pygoscelis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_008825305.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Pygoscelis adeliae Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1298
                     /organism="Pygoscelis adeliae"
                     /mol_type="mRNA"
                     /isolate="BGI_AS28"
                     /db_xref="taxon:9238"
                     /chromosome="Unknown"
                     /sex="male"
                     /country="Antarctica"
     gene            1..1298
                     /gene="HOXB8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 10 Proteins, and 66% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:103922072"
     CDS             1..729
                     /gene="HOXB8"
                     /codon_start=1
                     /product="homeobox protein Hox-B8 isoform X1"
                     /protein_id="XP_009328420.1"
                     /db_xref="GeneID:103922072"
                     /translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPSNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"
     misc_feature    order(436..450,454..456,505..507,523..525,562..564,
                     568..573,580..585,589..597,601..606)
                     /gene="HOXB8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(442..444,451..453,571..573,580..585,592..594)
                     /gene="HOXB8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    445..603
                     /gene="HOXB8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
ORIGIN      
atgagctcttattttgtcaactcactcttctccaaatacaaaaccggggactccttacgtcccaattactatgactgcgggttcgctcaggatcttgggggcagacccacggtggtgtacggacccagcacggggggcaccttccagcatccgacccaaatccaggagttttaccacggagcatcctcactctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggaccccagcaacttctatggctacgaccccttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagcttgctgccagcggccttggagaggaggcggagagctcggagcagagcccttctccgacccagcttttcccctggatgcgaccgcaagcagccgctggacggaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcgctgctggggtggaagagcccctgagccccacgttaatggcagttaatgtaagggaggggtgggaaaaaaaccaacaatgcatagaaaagagaaaggaaaaaaaaaaaaaacccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatcgggaggtctctcctgccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaattctctctctctctctgtctttctctctgtctctctcttctgtccgggggggtgggttggttaacatagctttcaatgctataggagttacgtgaaattacatttgtgcactttttttttttttaattttccacctttttggttgtgatttatctgtatgtactggaggtagctattgaaacaaacatcccaacaacatgaaactgcctatttatgctatagttatctctccctttctctctctttctctctttactttccata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]