2024-05-18 23:27:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009287747 1281 bp mRNA linear VRT 05-DEC-2016 DEFINITION PREDICTED: Aptenodytes forsteri homeobox B8 (HOXB8), transcript variant X1, mRNA. ACCESSION XM_009287747 VERSION XM_009287747.1 DBLINK BioProject: PRJNA261081 KEYWORDS RefSeq. SOURCE Aptenodytes forsteri (emperor penguin) ORGANISM Aptenodytes forsteri Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Sphenisciformes; Spheniscidae; Aptenodytes. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_008796180.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Aptenodytes forsteri Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1281 /organism="Aptenodytes forsteri" /mol_type="mRNA" /isolate="BGI_AS27" /db_xref="taxon:9233" /chromosome="Unknown" /sex="male" /country="Antarctica" gene 1..1281 /gene="HOXB8" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 65% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:103905941" CDS 1..729 /gene="HOXB8" /codon_start=1 /product="homeobox protein Hox-B8 isoform X1" /protein_id="XP_009286022.1" /db_xref="GeneID:103905941" /translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPSNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAAGRRRGGETYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"
misc_feature order(436..450,454..456,505..507,523..525,562..564, 568..573,580..585,589..597,601..606) /gene="HOXB8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(442..444,451..453,571..573,580..585,592..594) /gene="HOXB8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 451..603 /gene="HOXB8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" ORIGIN
atgagctcttattttgtcaactcactcttctccaaatacaaaaccggggactccttgcgtcccaattactatgactgcgggttcgctcaggatcttgggggcagacccacggtggtgtacggacccagcacggggggcaccttccagcatccgacccaaatccaggagttttaccacggagcatcctcactctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggaccccagcaacttctatggctacgaccccttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagcttgctgccagcggccttggagaggaggcggagagctcggagcagagcccttctccgacccagcttttcccctggatgcgaccgcaagcagccgctggacggaggagggggggggaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcgctgctggggtggaagagcccctgagccccacgttaatggcagttaatgtaagggaggggtgggaaaaaaaccaacaatgcatagaaaagagaaaggaaaaaaaaaaaaaacccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatcgggaggtctctcctgccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaattctctctctctctctgtctttctctctgtctctctcttctgtcctggggggtgggttggttaacatagctttcaatgctataggagttacgtgaaattacatttgtgcactttttttttttaattttccacctttttggttgtggtttatctgtatgtactggaggtagctattgaaacaaacatcccaacaacatgaaactgcctatttatgcaatagttatctctccctttctctctctttctc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]