2025-07-04 14:46:47, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_009177955 474 bp mRNA linear INV 12-SEP-2014 DEFINITION Opisthorchis viverrini hypothetical protein partial mRNA. ACCESSION XM_009177955 VERSION XM_009177955.1 DBLINK BioProject: PRJNA259756 BioSample: SAMN00996407 KEYWORDS RefSeq. SOURCE Opisthorchis viverrini ORGANISM Opisthorchis viverrini Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes; Trematoda; Digenea; Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis. REFERENCE 1 (bases 1 to 474) AUTHORS Young,N.D., Nagarajan,N., Lin,S.J., Korhonen,P.K., Jex,A.R., Hall,R.S., Safavi-Hemami,H., Kaewkong,W., Bertrand,D., Gao,S., Seet,Q., Wongkham,S., Teh,B.T., Wongkham,C., Intapan,P.M., Maleewong,W., Yang,X., Hu,M., Wang,Z., Hofmann,A., Sternberg,P.W., Tan,P., Wang,J. and Gasser,R.B. TITLE Opisthorchis viverrini - life in the bile duct JOURNAL Unpublished REFERENCE 2 (bases 1 to 474) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (11-SEP-2014) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 474) AUTHORS Young,N.D., Nagarajan,N., Lin,S.J., Korhonen,P.K., Jex,A.R., Hall,R.S., Safavi-Hemami,H., Kaewkong,W., Bertrand,D., Gao,S., Seet,Q., Wongkham,S., Teh,B.T., Wongkham,C., Intapan,P.M., Maleewong,W., Yang,X., Hu,M., Wang,Z., Hofmann,A., Sternberg,P.W., Tan,P., Wang,J. and Gasser,R.B. TITLE Direct Submission JOURNAL Submitted (27-NOV-2013) Faculty of Veterinary Science, The University of Melbourne, Cnr Park Drive and Flemington Road, Parkville 3010, Australia COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_008752140). COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..474 /organism="Opisthorchis viverrini" /mol_type="mRNA" /db_xref="taxon:6198" /chromosome="Unknown" /geo_loc_name="Thailand: Khon Kaen" /collection_date="Jan-2010" gene 1..>474 /locus_tag="T265_11327" /db_xref="GeneID:20325495" CDS 1..474 /locus_tag="T265_11327" /codon_start=1 /product="hypothetical protein" /protein_id="XP_009176219.1" /db_xref="GeneID:20325495" /translation="
MGAVAGLNAKRFSSHGDGKDDGESGHSNRLEENVCGRIIGIGKEEKAEAHDVLISTLDVSFCAMECLPVGIFQGHYDLLVLRNDGAIEYVFSALFGILNYPLEQVGFGSGSIRPLFRCILPLAKLRPIHYFRPPTILNGIDVPPAIGDYERPLPSTA"
ORIGIN
atgggggcagttgctgggttgaatgcaaagcgcttctctagccacggtgacgggaaggatgatggggaatctgggcacagcaatcgcttagaagaaaatgtgtgcggccgcattatcggcatcggaaaagaggaaaaagccgaagcacatgatgtgttaattagtacgttagacgtgtcgttctgcgcgatggaatgtctcccagttggaatatttcaaggtcattatgacctactggtgctccgcaacgatggggctatagagtatgtgttcagcgcacttttcggtattttgaattatccattggaacaggtcggcttcggcagcgggtctattcggccgcttttcaggtgtatcttgccacttgcaaagctgcgtcccattcactactttcgacctccgaccatcttgaatggtatagacgttcccccagcgatcggtgactacgaacgtcccttgccatcgactgcctag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]