GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-04 14:46:47, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_009177955             474 bp    mRNA    linear   INV 12-SEP-2014
DEFINITION  Opisthorchis viverrini hypothetical protein partial mRNA.
ACCESSION   XM_009177955
VERSION     XM_009177955.1
DBLINK      BioProject: PRJNA259756
            BioSample: SAMN00996407
KEYWORDS    RefSeq.
SOURCE      Opisthorchis viverrini
  ORGANISM  Opisthorchis viverrini
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes;
            Trematoda; Digenea; Opisthorchiida; Opisthorchiata;
            Opisthorchiidae; Opisthorchis.
REFERENCE   1  (bases 1 to 474)
  AUTHORS   Young,N.D., Nagarajan,N., Lin,S.J., Korhonen,P.K., Jex,A.R.,
            Hall,R.S., Safavi-Hemami,H., Kaewkong,W., Bertrand,D., Gao,S.,
            Seet,Q., Wongkham,S., Teh,B.T., Wongkham,C., Intapan,P.M.,
            Maleewong,W., Yang,X., Hu,M., Wang,Z., Hofmann,A., Sternberg,P.W.,
            Tan,P., Wang,J. and Gasser,R.B.
  TITLE     Opisthorchis viverrini - life in the bile duct
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 474)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-SEP-2014) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 474)
  AUTHORS   Young,N.D., Nagarajan,N., Lin,S.J., Korhonen,P.K., Jex,A.R.,
            Hall,R.S., Safavi-Hemami,H., Kaewkong,W., Bertrand,D., Gao,S.,
            Seet,Q., Wongkham,S., Teh,B.T., Wongkham,C., Intapan,P.M.,
            Maleewong,W., Yang,X., Hu,M., Wang,Z., Hofmann,A., Sternberg,P.W.,
            Tan,P., Wang,J. and Gasser,R.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2013) Faculty of Veterinary Science, The
            University of Melbourne, Cnr Park Drive and Flemington Road,
            Parkville 3010, Australia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_008752140).
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..474
                     /organism="Opisthorchis viverrini"
                     /mol_type="mRNA"
                     /db_xref="taxon:6198"
                     /chromosome="Unknown"
                     /geo_loc_name="Thailand: Khon Kaen"
                     /collection_date="Jan-2010"
     gene            1..>474
                     /locus_tag="T265_11327"
                     /db_xref="GeneID:20325495"
     CDS             1..474
                     /locus_tag="T265_11327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009176219.1"
                     /db_xref="GeneID:20325495"
                     /translation="
MGAVAGLNAKRFSSHGDGKDDGESGHSNRLEENVCGRIIGIGKEEKAEAHDVLISTLDVSFCAMECLPVGIFQGHYDLLVLRNDGAIEYVFSALFGILNYPLEQVGFGSGSIRPLFRCILPLAKLRPIHYFRPPTILNGIDVPPAIGDYERPLPSTA"
ORIGIN      
atgggggcagttgctgggttgaatgcaaagcgcttctctagccacggtgacgggaaggatgatggggaatctgggcacagcaatcgcttagaagaaaatgtgtgcggccgcattatcggcatcggaaaagaggaaaaagccgaagcacatgatgtgttaattagtacgttagacgtgtcgttctgcgcgatggaatgtctcccagttggaatatttcaaggtcattatgacctactggtgctccgcaacgatggggctatagagtatgtgttcagcgcacttttcggtattttgaattatccattggaacaggtcggcttcggcagcgggtctattcggccgcttttcaggtgtatcttgccacttgcaaagctgcgtcccattcactactttcgacctccgaccatcttgaatggtatagacgttcccccagcgatcggtgactacgaacgtcccttgccatcgactgcctag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]