ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-19 15:12:46, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_009177955 474 bp mRNA linear INV 12-SEP-2014
DEFINITION Opisthorchis viverrini hypothetical protein partial mRNA.
ACCESSION XM_009177955
VERSION XM_009177955.1
DBLINK BioProject: PRJNA259756
BioSample: SAMN00996407
KEYWORDS RefSeq.
SOURCE Opisthorchis viverrini
ORGANISM Opisthorchis viverrini
Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes;
Trematoda; Digenea; Opisthorchiida; Opisthorchiata;
Opisthorchiidae; Opisthorchis.
REFERENCE 1 (bases 1 to 474)
AUTHORS Young,N.D., Nagarajan,N., Lin,S.J., Korhonen,P.K., Jex,A.R.,
Hall,R.S., Safavi-Hemami,H., Kaewkong,W., Bertrand,D., Gao,S.,
Seet,Q., Wongkham,S., Teh,B.T., Wongkham,C., Intapan,P.M.,
Maleewong,W., Yang,X., Hu,M., Wang,Z., Hofmann,A., Sternberg,P.W.,
Tan,P., Wang,J. and Gasser,R.B.
TITLE Opisthorchis viverrini - life in the bile duct
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 474)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (11-SEP-2014) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 474)
AUTHORS Young,N.D., Nagarajan,N., Lin,S.J., Korhonen,P.K., Jex,A.R.,
Hall,R.S., Safavi-Hemami,H., Kaewkong,W., Bertrand,D., Gao,S.,
Seet,Q., Wongkham,S., Teh,B.T., Wongkham,C., Intapan,P.M.,
Maleewong,W., Yang,X., Hu,M., Wang,Z., Hofmann,A., Sternberg,P.W.,
Tan,P., Wang,J. and Gasser,R.B.
TITLE Direct Submission
JOURNAL Submitted (27-NOV-2013) Faculty of Veterinary Science, The
University of Melbourne, Cnr Park Drive and Flemington Road,
Parkville 3010, Australia
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_008752140).
COMPLETENESS: incomplete on the 3' end.
FEATURES Location/Qualifiers
source 1..474
/organism="Opisthorchis viverrini"
/mol_type="mRNA"
/db_xref="taxon:6198"
/chromosome="Unknown"
/geo_loc_name="Thailand: Khon Kaen"
/collection_date="Jan-2010"
gene 1..>474
/locus_tag="T265_11327"
/db_xref="GeneID:20325495"
CDS 1..474
/locus_tag="T265_11327"
/codon_start=1
/product="hypothetical protein"
/protein_id="XP_009176219.1"
/db_xref="GeneID:20325495"
/translation="
MGAVAGLNAKRFSSHGDGKDDGESGHSNRLEENVCGRIIGIGKEEKAEAHDVLISTLDVSFCAMECLPVGIFQGHYDLLVLRNDGAIEYVFSALFGILNYPLEQVGFGSGSIRPLFRCILPLAKLRPIHYFRPPTILNGIDVPPAIGDYERPLPSTA"
ORIGIN
atgggggcagttgctgggttgaatgcaaagcgcttctctagccacggtgacgggaaggatgatggggaatctgggcacagcaatcgcttagaagaaaatgtgtgcggccgcattatcggcatcggaaaagaggaaaaagccgaagcacatgatgtgttaattagtacgttagacgtgtcgttctgcgcgatggaatgtctcccagttggaatatttcaaggtcattatgacctactggtgctccgcaacgatggggctatagagtatgtgttcagcgcacttttcggtattttgaattatccattggaacaggtcggcttcggcagcgggtctattcggccgcttttcaggtgtatcttgccacttgcaaagctgcgtcccattcactactttcgacctccgaccatcttgaatggtatagacgttcccccagcgatcggtgactacgaacgtcccttgccatcgactgcctag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]