GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 04:31:51, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_009030703             168 bp    mRNA    linear   INV 03-SEP-2014
DEFINITION  Helobdella robusta hypothetical protein partial mRNA.
ACCESSION   XM_009030703
VERSION     XM_009030703.1
DBLINK      BioProject: PRJNA259764
KEYWORDS    RefSeq.
SOURCE      Helobdella robusta
  ORGANISM  Helobdella robusta
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Annelida; Clitellata;
            Hirudinea; Rhynchobdellida; Glossiphoniidae; Helobdella.
REFERENCE   1  (bases 1 to 168)
  AUTHORS   Simakov,O., Marletaz,F., Cho,S.J., Edsinger-Gonzales,E., Havlak,P.,
            Hellsten,U., Kuo,D.H., Larsson,T., Lv,J., Arendt,D., Savage,R.,
            Osoegawa,K., de Jong,P., Grimwood,J., Chapman,J.A., Shapiro,H.,
            Aerts,A., Otillar,R.P., Terry,A.Y., Boore,J.L., Grigoriev,I.V.,
            Lindberg,D.R., Seaver,E.C., Weisblat,D.A., Putnam,N.H. and
            Rokhsar,D.S.
  TITLE     Insights into bilaterian evolution from three spiralian genomes
  JOURNAL   Nature 493 (7433), 526-531 (2013)
   PUBMED   23254933
REFERENCE   2  (bases 1 to 168)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-SEP-2014) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 168)
  AUTHORS   Hellsten,U., Grimwood,J., Chapman,J.A., Shapiro,H., Aerts,A.,
            Otillar,R.P., Terry,A.Y., Boore,J.L., Simakov,O., Marletaz,F.,
            Cho,S.-J., Edsinger-Gonzales,E., Havlak,P., Kuo,D.-H., Larsson,T.,
            Lv,J., Arendt,D., Savage,R., Osoegawa,K., de Jong,P.,
            Lindberg,D.R., Seaver,E.C., Weisblat,D.A., Putnam,N.H.,
            Grigoriev,I.V. and Rokhsar,D.S.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2012) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_008705398).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..168
                     /organism="Helobdella robusta"
                     /mol_type="mRNA"
                     /db_xref="taxon:6412"
                     /chromosome="Unknown"
     gene            <1..>168
                     /locus_tag="HELRODRAFT_137893"
                     /db_xref="GeneID:20196445"
     CDS             <1..>168
                     /locus_tag="HELRODRAFT_137893"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009028951.1"
                     /db_xref="GeneID:20196445"
                     /db_xref="JGIDB:Helro1_137893"
                     /translation="
NGDYVEIQTSFGLTVSYNPLWRLKVTVTSAFSNQVTGSCGNFDGNPSNDVKMVNGA"
     misc_feature    <1..165
                     /locus_tag="HELRODRAFT_137893"
                     /note="von Willebrand factor type D domain; Region: VWD;
                     cl02516"
                     /db_xref="CDD:295339"
ORIGIN      
aatggcgactacgttgaaattcaaacctctttcgggctgaccgtgtcatacaaccccctgtggaggttaaaggtcacagtgacctccgccttcagtaatcaagtgaccggaagttgcggaaattttgacggaaatccaagtaatgatgtcaaaatggtgaacggcgct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]