GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-21 18:06:11, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_008769186             588 bp    mRNA    linear   ROD 22-FEB-2024
DEFINITION  PREDICTED: Rattus norvegicus claudin-4-like (LOC103691506), mRNA.
ACCESSION   XM_008769186
VERSION     XM_008769186.1
DBLINK      BioProject: PRJNA1074393
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_086030) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036323735.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/09/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..588
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /bio_material="RGD 61498"
                     /db_xref="taxon:10116"
                     /chromosome="12"
                     /sex="male"
                     /tissue_type="kidney, spleen, liver"
                     /geo_loc_name="USA: Wisconsin, Milwaukee"
                     /lat_lon="43.05 N 88.04 W"
                     /collected_by="Rebecca Schilling, Melinda Dwinell"
     gene            1..588
                     /gene="LOC103691506"
                     /note="claudin-4-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 7 Proteins"
                     /db_xref="GeneID:103691506"
                     /db_xref="RGD:9242288"
     CDS             1..588
                     /gene="LOC103691506"
                     /codon_start=1
                     /product="claudin-4-like"
                     /protein_id="XP_008767408.1"
                     /db_xref="GeneID:103691506"
                     /db_xref="RGD:9242288"
                     /translation="
MASLGQQAVIEFSGSDIIRQSTIWKGLWKSCVAQEGHQTQCKAYDSLLGRPESWQKSRVLMVTCIITAGLGLLLCVVRSKCLKCVEEENTKAKIRMGAGALCLLAGLLVTVSVSWVTHDIMQGFSSRLIPSVQKGKMGAVLYIGWASSGLLLLGGPLLSCNCSPLTDRRHSVRYQAASSSIVCNSGLNPPNAATL"
     misc_feature    <64..438
                     /gene="LOC103691506"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
atggcttccctagggcagcaggcggtgatagaattttctggtagtgacatcatcagacagtcaactatctggaagggcttgtggaagtcctgtgtggcacaagagggtcaccagactcagtgcaaggcctatgactccctgctgggacgtcctgagtcttggcagaagtctcgggtcctcatggtcacgtgtatcatcacagctggactgggtttgcttctgtgcgtggtccggagcaagtgtttgaagtgtgtggaggaggagaacaccaaagccaagatcaggatgggggcaggggcattgtgcctgctggctggcctgctagtgacggtgtctgtgtcctgggtaacacacgacatcatgcaaggattctccagccggctgatcccctccgtgcagaagggaaagatgggtgctgtcctctacattggctgggccagctcaggattgctgcttctaggaggacccttgctctcctgcaactgctcacccctcactgaccgccgtcactcagtcaggtaccaagcggccagctccagcatcgtctgtaacagtggtctcaaccctcctaatgcggcgaccctctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]