LOCUS       XM_008239388             759 bp    mRNA    linear   PLN 11-MAY-2016
DEFINITION  PREDICTED: Prunus mume zinc finger MYM-type protein 1-like
            (LOC103336345), mRNA.
ACCESSION   XM_008239388
VERSION     XM_008239388.1
DBLINK      BioProject: PRJNA246160
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Prunus mume (Japanese apricot)
  ORGANISM  Prunus mume
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae;
            Amygdaleae; Prunus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_024131.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Prunus mume Annotation Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..759
                     /organism="Prunus mume"
                     /mol_type="mRNA"
                     /isolate="4"
                     /db_xref="taxon:102107"
                     /country="China: Tongmai, Bomi County, Tibet"
                     /lat_lon="30.1039 N 95.0856 E"
                     /linkage_group="LG6"
     gene            1..759
                     /gene="LOC103336345"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:103336345"
     CDS             1..759
                     /gene="LOC103336345"
                     /codon_start=1
                     /product="zinc finger MYM-type protein 1-like"
                     /protein_id="XP_008237610.1"
                     /db_xref="GeneID:103336345"
                     /translation="

MRGEFNGLKTKILREQPCAFYVHCFAHQLQLALVAVVKKNIDVNSFFTTANSLVNVVGASCKHQDALRAQYQEEIVRAFEEDCLITGRGLNKKNTLKRAGDTRWNSHYGTLISIISMFPSVVNVLQMIVDDNPNDSSGEAYKLWREIQSFEFVFHLFLMKAILGITNTLSLALQKKDQDIVNAMSLVTTCKENLQFMRDNEFEELVEQASSFCYKHDITVPTMDEEYVISGRSRRNAPMKTNYHRYRVEITM"

ORIGIN      

atgagaggtgagttcaatggccttaagacaaagattttgagagaacaaccttgtgcattttatgttcattgttttgctcatcaacttcaactagctcttgttgcggtagtaaagaaaaacattgatgtcaattcttttttcacaacggctaatagtttggttaatgttgttggagcatcttgtaagcatcaggatgcacttagagcacaataccaagaagagattgtgagagcttttgaagaagattgtcttataacggggcggggcttaaataaaaaaaatactctcaaacgtgccggcgatacacgatggaactcacattatggtacgttgattagtatcatttctatgttcccatctgtggtgaatgtgcttcaaatgattgttgatgataatcctaatgatagttcgggtgaagcctataagttatggagagaaatacaatcttttgagtttgtgtttcacttatttttaatgaaagctatattgggaataacaaacactttgtctctagcattgcaaaagaaagatcaagacattgtaaatgcaatgagtttagtgacaacatgcaaggaaaacctgcagttcatgagggataatgagtttgaagaattggttgagcaagcatcttcgttttgttacaaacatgatattaccgttcctaccatggatgaggaatatgtaatttcagggagatcacggcgtaatgctccaatgaagacaaattatcatcgttatcgtgtggagatcacgatgtaa

//