ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-19 12:57:22, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_008239388 759 bp mRNA linear PLN 11-MAY-2016
DEFINITION PREDICTED: Prunus mume zinc finger MYM-type protein 1-like
(LOC103336345), mRNA.
ACCESSION XM_008239388
VERSION XM_008239388.1
DBLINK BioProject: PRJNA246160
KEYWORDS RefSeq; includes ab initio.
SOURCE Prunus mume (Japanese apricot)
ORGANISM Prunus mume
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae;
Amygdaleae; Prunus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_024131.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Prunus mume Annotation Release 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 7.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..759
/organism="Prunus mume"
/mol_type="mRNA"
/isolate="4"
/db_xref="taxon:102107"
/geo_loc_name="China: Tongmai, Bomi County, Tibet"
/lat_lon="30.1039 N 95.0856 E"
/linkage_group="LG6"
gene 1..759
/gene="LOC103336345"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 2 Proteins"
/db_xref="GeneID:103336345"
CDS 1..759
/gene="LOC103336345"
/codon_start=1
/product="zinc finger MYM-type protein 1-like"
/protein_id="XP_008237610.1"
/db_xref="GeneID:103336345"
/translation="
MRGEFNGLKTKILREQPCAFYVHCFAHQLQLALVAVVKKNIDVNSFFTTANSLVNVVGASCKHQDALRAQYQEEIVRAFEEDCLITGRGLNKKNTLKRAGDTRWNSHYGTLISIISMFPSVVNVLQMIVDDNPNDSSGEAYKLWREIQSFEFVFHLFLMKAILGITNTLSLALQKKDQDIVNAMSLVTTCKENLQFMRDNEFEELVEQASSFCYKHDITVPTMDEEYVISGRSRRNAPMKTNYHRYRVEITM"
ORIGIN
atgagaggtgagttcaatggccttaagacaaagattttgagagaacaaccttgtgcattttatgttcattgttttgctcatcaacttcaactagctcttgttgcggtagtaaagaaaaacattgatgtcaattcttttttcacaacggctaatagtttggttaatgttgttggagcatcttgtaagcatcaggatgcacttagagcacaataccaagaagagattgtgagagcttttgaagaagattgtcttataacggggcggggcttaaataaaaaaaatactctcaaacgtgccggcgatacacgatggaactcacattatggtacgttgattagtatcatttctatgttcccatctgtggtgaatgtgcttcaaatgattgttgatgataatcctaatgatagttcgggtgaagcctataagttatggagagaaatacaatcttttgagtttgtgtttcacttatttttaatgaaagctatattgggaataacaaacactttgtctctagcattgcaaaagaaagatcaagacattgtaaatgcaatgagtttagtgacaacatgcaaggaaaacctgcagttcatgagggataatgagtttgaagaattggttgagcaagcatcttcgttttgttacaaacatgatattaccgttcctaccatggatgaggaatatgtaatttcagggagatcacggcgtaatgctccaatgaagacaaattatcatcgttatcgtgtggagatcacgatgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]