2025-07-13 15:10:20, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_008042664 132 bp mRNA linear PLN 18-APR-2022 DEFINITION Trametes versicolor FP-101664 SS1 pheromone (TRAVEDRAFT_184727), partial mRNA. ACCESSION XM_008042664 VERSION XM_008042664.1 DBLINK BioProject: PRJNA242547 BioSample: SAMN02981287 KEYWORDS RefSeq. SOURCE Trametes versicolor FP-101664 SS1 ORGANISM Trametes versicolor FP-101664 SS1 Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Polyporales; Polyporaceae; Trametes. REFERENCE 1 (bases 1 to 132) AUTHORS Floudas,D., Binder,M., Riley,R., Barry,K., Blanchette,R.A., Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W., Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A., Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B., Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C., Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A., Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F., Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R., McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G., Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J., Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St. John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A., Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F., Cullen,D., Grigoriev,I.V. and Hibbett,D.S. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE The Paleozoic origin of enzymatic mechanisms for decay of lignin reconstructed using 31 fungal genomes JOURNAL Unpublished REFERENCE 2 (bases 1 to 132) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 132) AUTHORS Riley,R., Floudas,D., Binder,M., Barry,K., Blanchette,R.A., Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W., Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A., Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B., Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C., Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A., Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F., Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R., McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G., Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J., Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St. John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A., Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F., Cullen,D., Hibbett,D.S. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (23-MAY-2012) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_007360328). ##Metadata-START## Organism Display Name :: Trametes versicolor SS1 GOLD Stamp ID :: Gi06086 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..132 /organism="Trametes versicolor FP-101664 SS1" /mol_type="mRNA" /strain="FP-101664 SS1" /db_xref="taxon:717944" /chromosome="Unknown" gene <1..>132 /locus_tag="TRAVEDRAFT_184727" /db_xref="GeneID:19411702" CDS 1..132 /locus_tag="TRAVEDRAFT_184727" /codon_start=1 /product="pheromone" /protein_id="XP_008040855.1" /db_xref="GeneID:19411702" /db_xref="InterPro:IPR012597" /db_xref="JGIDB:Trave1_184727" /translation="
MDAFFTIAPAVPETSAEAQPLEDILVECDKTGTSGNKGSCIIA"
ORIGIN
atggacgcgttcttcaccatcgcccccgccgttccggagacctccgccgaggcgcagccgctcgaggacattctcgtcgagtgcgacaagaccgggacgagcgggaacaagggcagctgcatcattgcttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]