ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-22 19:29:05, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_008042664 132 bp mRNA linear PLN 18-APR-2022
DEFINITION Trametes versicolor FP-101664 SS1 pheromone (TRAVEDRAFT_184727),
partial mRNA.
ACCESSION XM_008042664
VERSION XM_008042664.1
DBLINK BioProject: PRJNA242547
BioSample: SAMN02981287
KEYWORDS RefSeq.
SOURCE Trametes versicolor FP-101664 SS1
ORGANISM Trametes versicolor FP-101664 SS1
Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
Agaricomycetes; Polyporales; Polyporaceae; Trametes.
REFERENCE 1 (bases 1 to 132)
AUTHORS Floudas,D., Binder,M., Riley,R., Barry,K., Blanchette,R.A.,
Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St.
John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
Cullen,D., Grigoriev,I.V. and Hibbett,D.S.
CONSRTM US DOE Joint Genome Institute (JGI-PGF)
TITLE The Paleozoic origin of enzymatic mechanisms for decay of lignin
reconstructed using 31 fungal genomes
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 132)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (15-APR-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 132)
AUTHORS Riley,R., Floudas,D., Binder,M., Barry,K., Blanchette,R.A.,
Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St.
John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
Cullen,D., Hibbett,D.S. and Grigoriev,I.V.
CONSRTM US DOE Joint Genome Institute (JGI-PGF)
TITLE Direct Submission
JOURNAL Submitted (23-MAY-2012) US DOE Joint Genome Institute, 2800
Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_007360328).
##Metadata-START##
Organism Display Name :: Trametes versicolor SS1
GOLD Stamp ID :: Gi06086
##Metadata-END##
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..132
/organism="Trametes versicolor FP-101664 SS1"
/mol_type="mRNA"
/strain="FP-101664 SS1"
/db_xref="taxon:717944"
/chromosome="Unknown"
gene <1..>132
/locus_tag="TRAVEDRAFT_184727"
/db_xref="GeneID:19411702"
CDS 1..132
/locus_tag="TRAVEDRAFT_184727"
/codon_start=1
/product="pheromone"
/protein_id="XP_008040855.1"
/db_xref="GeneID:19411702"
/db_xref="InterPro:IPR012597"
/db_xref="JGIDB:Trave1_184727"
/translation="
MDAFFTIAPAVPETSAEAQPLEDILVECDKTGTSGNKGSCIIA"
ORIGIN
atggacgcgttcttcaccatcgcccccgccgttccggagacctccgccgaggcgcagccgctcgaggacattctcgtcgagtgcgacaagaccgggacgagcgggaacaagggcagctgcatcattgcttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]