GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 08:10:10, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_008042664             132 bp    mRNA    linear   PLN 18-APR-2022
DEFINITION  Trametes versicolor FP-101664 SS1 pheromone (TRAVEDRAFT_184727),
            partial mRNA.
ACCESSION   XM_008042664
VERSION     XM_008042664.1
DBLINK      BioProject: PRJNA242547
            BioSample: SAMN02981287
KEYWORDS    RefSeq.
SOURCE      Trametes versicolor FP-101664 SS1
  ORGANISM  Trametes versicolor FP-101664 SS1
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Polyporales; Polyporaceae; Trametes.
REFERENCE   1  (bases 1 to 132)
  AUTHORS   Floudas,D., Binder,M., Riley,R., Barry,K., Blanchette,R.A.,
            Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
            Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
            Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
            Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
            Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
            Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
            Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
            McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
            Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
            Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St.
            John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
            Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
            Cullen,D., Grigoriev,I.V. and Hibbett,D.S.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     The Paleozoic origin of enzymatic mechanisms for decay of lignin
            reconstructed using 31 fungal genomes
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 132)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 132)
  AUTHORS   Riley,R., Floudas,D., Binder,M., Barry,K., Blanchette,R.A.,
            Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
            Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
            Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
            Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
            Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
            Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
            Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
            McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
            Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
            Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St.
            John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
            Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
            Cullen,D., Hibbett,D.S. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAY-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_007360328).
            
            ##Metadata-START##
            Organism Display Name :: Trametes versicolor SS1
            GOLD Stamp ID         :: Gi06086
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..132
                     /organism="Trametes versicolor FP-101664 SS1"
                     /mol_type="mRNA"
                     /strain="FP-101664 SS1"
                     /db_xref="taxon:717944"
                     /chromosome="Unknown"
     gene            <1..>132
                     /locus_tag="TRAVEDRAFT_184727"
                     /db_xref="GeneID:19411702"
     CDS             1..132
                     /locus_tag="TRAVEDRAFT_184727"
                     /codon_start=1
                     /product="pheromone"
                     /protein_id="XP_008040855.1"
                     /db_xref="GeneID:19411702"
                     /db_xref="InterPro:IPR012597"
                     /db_xref="JGIDB:Trave1_184727"
                     /translation="
MDAFFTIAPAVPETSAEAQPLEDILVECDKTGTSGNKGSCIIA"
ORIGIN      
atggacgcgttcttcaccatcgcccccgccgttccggagacctccgccgaggcgcagccgctcgaggacattctcgtcgagtgcgacaagaccgggacgagcgggaacaagggcagctgcatcattgcttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]