2024-05-20 10:06:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_007871969 225 bp mRNA linear PLN 02-JAN-2024 DEFINITION Gloeophyllum trabeum ATCC 11539 uncharacterized protein (GLOTRDRAFT_48993), partial mRNA. ACCESSION XM_007871969 VERSION XM_007871969.1 DBLINK BioProject: PRJNA245137 BioSample: SAMN02743873 KEYWORDS RefSeq. SOURCE Gloeophyllum trabeum ATCC 11539 ORGANISM Gloeophyllum trabeum ATCC 11539 Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Gloeophyllum. REFERENCE 1 (bases 1 to 225) AUTHORS Floudas,D., Binder,M., Riley,R., Barry,K., Blanchette,R.A., Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W., Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A., Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B., Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C., Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A., Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F., Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R., McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G., Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J., Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A., Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F., Cullen,D., Grigoriev,I.V. and Hibbett,D.S. TITLE The Paleozoic origin of enzymatic lignin decomposition reconstructed from 31 fungal genomes JOURNAL Science 336 (6089), 1715-1719 (2012) PUBMED 22745431 REFERENCE 2 (bases 1 to 225) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 225) AUTHORS Riley,R., Floudas,D., Binder,M., Barry,K., Blanchette,R.A., Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W., Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A., Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B., Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C., Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A., Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F., Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R., McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G., Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J., Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A., Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F., Cullen,D., Hibbett,D.S. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (26-JUN-2012) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_006920425). ##Metadata-START## Organism Display Name :: Gloeophyllum trabeum ATCC 11539 GOLD Stamp ID :: Gi04922 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..225 /organism="Gloeophyllum trabeum ATCC 11539" /mol_type="mRNA" /strain="ATCC 11539" /culture_collection="ATCC:11539" /db_xref="taxon:670483" /chromosome="Unknown" gene <1..>225 /locus_tag="GLOTRDRAFT_48993" /db_xref="GeneID:19306618" CDS 1..225 /locus_tag="GLOTRDRAFT_48993" /note="predicted protein" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_007870160.1" /db_xref="GeneID:19306618" /db_xref="JGIDB:Glotr1_1_48993" /translation="
MEGHKKHFLTGMVYHGEYHFNCRFIDKTGTIWYNDGISTGRQCVIEGTLSNTDMTDLTKCKGKDISLVIYARRY"
ORIGIN
atggaaggacacaagaaacactttttaacaggaatggtctaccatggcgagtaccatttcaactgtcgattcattgacaaaactgggacaatatggtacaatgacggtataagcacaggcagacagtgcgtaattgaaggaaccttatcgaatacagatatgactgacttaaccaaatgtaaagggaaagacatttcattagtaatatacgcacggcgctattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]