ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-24 12:55:00, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_007871969 225 bp mRNA linear PLN 02-JAN-2024
DEFINITION Gloeophyllum trabeum ATCC 11539 uncharacterized protein
(GLOTRDRAFT_48993), partial mRNA.
ACCESSION XM_007871969
VERSION XM_007871969.1
DBLINK BioProject: PRJNA245137
BioSample: SAMN02743873
KEYWORDS RefSeq.
SOURCE Gloeophyllum trabeum ATCC 11539
ORGANISM Gloeophyllum trabeum ATCC 11539
Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Gloeophyllum.
REFERENCE 1 (bases 1 to 225)
AUTHORS Floudas,D., Binder,M., Riley,R., Barry,K., Blanchette,R.A.,
Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St
John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
Cullen,D., Grigoriev,I.V. and Hibbett,D.S.
TITLE The Paleozoic origin of enzymatic lignin decomposition
reconstructed from 31 fungal genomes
JOURNAL Science 336 (6089), 1715-1719 (2012)
PUBMED 22745431
REFERENCE 2 (bases 1 to 225)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 225)
AUTHORS Riley,R., Floudas,D., Binder,M., Barry,K., Blanchette,R.A.,
Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St
John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
Cullen,D., Hibbett,D.S. and Grigoriev,I.V.
CONSRTM US DOE Joint Genome Institute (JGI-PGF)
TITLE Direct Submission
JOURNAL Submitted (26-JUN-2012) US DOE Joint Genome Institute, 2800
Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_006920425).
##Metadata-START##
Organism Display Name :: Gloeophyllum trabeum ATCC 11539
GOLD Stamp ID :: Gi04922
##Metadata-END##
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..225
/organism="Gloeophyllum trabeum ATCC 11539"
/mol_type="mRNA"
/strain="ATCC 11539"
/culture_collection="ATCC:11539"
/db_xref="taxon:670483"
/chromosome="Unknown"
gene <1..>225
/locus_tag="GLOTRDRAFT_48993"
/db_xref="GeneID:19306618"
CDS 1..225
/locus_tag="GLOTRDRAFT_48993"
/note="predicted protein"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_007870160.1"
/db_xref="GeneID:19306618"
/db_xref="JGIDB:Glotr1_1_48993"
/translation="
MEGHKKHFLTGMVYHGEYHFNCRFIDKTGTIWYNDGISTGRQCVIEGTLSNTDMTDLTKCKGKDISLVIYARRY"
ORIGIN
atggaaggacacaagaaacactttttaacaggaatggtctaccatggcgagtaccatttcaactgtcgattcattgacaaaactgggacaatatggtacaatgacggtataagcacaggcagacagtgcgtaattgaaggaaccttatcgaatacagatatgactgacttaaccaaatgtaaagggaaagacatttcattagtaatatacgcacggcgctattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]