GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 03:24:34, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_006984001             472 bp    mRNA    linear   ROD 21-MAR-2016
DEFINITION  PREDICTED: Peromyscus maniculatus bairdii prefoldin subunit 4-like
            (LOC102907957), mRNA.
ACCESSION   XM_006984001
VERSION     XM_006984001.2
DBLINK      BioProject: PRJNA237107
KEYWORDS    RefSeq.
SOURCE      Peromyscus maniculatus bairdii (prairie deer mouse)
  ORGANISM  Peromyscus maniculatus bairdii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Cricetidae; Neotominae; Peromyscus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006501252.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Mar 21, 2016 this sequence version replaced XM_006984001.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Peromyscus maniculatus bairdii
                                           Annotation Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..472
                     /organism="Peromyscus maniculatus bairdii"
                     /mol_type="mRNA"
                     /sub_species="bairdii"
                     /db_xref="taxon:230844"
                     /chromosome="Unknown"
     gene            1..472
                     /gene="LOC102907957"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 mRNAs, 4 ESTs, 6 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 2 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:102907957"
     CDS             16..408
                     /gene="LOC102907957"
                     /codon_start=1
                     /product="prefoldin subunit 4-like"
                     /protein_id="XP_006984063.2"
                     /db_xref="GeneID:102907957"
                     /translation="
MLCQAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKHLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKTLQEEIDALESRVASIQRVLADLKVQLYAKFGSNINLEADES"
     misc_feature    61..375
                     /gene="LOC102907957"
                     /note="Prefoldin subunit; Region: Prefoldin_2; pfam01920"
                     /db_xref="CDD:280154"
ORIGIN      
gactcatctggcaagatgctgtgtcaggctgcagaagatgtcaatgttactttcgaagatcagcaaaaaataaacaaatttgctcgaaatacgagtcgaatcacagagctaaaggaggaaatagaagtgaagaagaaacacctccagaatttagaagacgcttgcgacgacatcatgctagcagatgacgactgcttaatgatcccgtaccagatcggagacgttttcattagccactctcaagaagaaacccaggaaatgttagaagaagcaaagaaaactttgcaagaagagattgatgccttagaatccagagtggcgtccatccagcgggtattagccgacttgaaagtacagttatacgcaaaatttggcagcaacataaaccttgaggcggatgaaagctaaacattttctaatactttttttttttaccttgtttaataaacttgaatattgtcttaaataataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]