GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-25 13:41:48, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_006957581             684 bp    mRNA    linear   PLN 12-JUL-2017
DEFINITION  Wallemia mellicola CBS 633.66 hypothetical protein mRNA.
ACCESSION   XM_006957581
VERSION     XM_006957581.1
DBLINK      BioProject: PRJNA225533
            BioSample: SAMN02769629
KEYWORDS    RefSeq.
SOURCE      Wallemia mellicola CBS 633.66
  ORGANISM  Wallemia mellicola CBS 633.66
            Eukaryota; Fungi; Dikarya; Basidiomycota; Wallemiomycotina;
            Wallemiomycetes; Wallemiales; Wallemiaceae; Wallemia.
REFERENCE   1  (bases 1 to 684)
  AUTHORS   Padamsee,M., Kumar,T.K., Riley,R., Binder,M., Boyd,A., Calvo,A.M.,
            Furukawa,K., Hesse,C., Hohmann,S., James,T.Y., LaButti,K.,
            Lapidus,A., Lindquist,E., Lucas,S., Miller,K., Shantappa,S.,
            Grigoriev,I.V., Hibbett,D.S., McLaughlin,D.J., Spatafora,J.W. and
            Aime,M.C.
  TITLE     The genome of the xerotolerant mold Wallemia sebi reveals
            adaptations to osmotic stress and suggests cryptic sexual
            reproduction
  JOURNAL   Fungal Genet. Biol. 49 (3), 217-226 (2012)
   PUBMED   22326418
REFERENCE   2  (bases 1 to 684)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUL-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 684)
  AUTHORS   Riley,R., LaButti,K., Lapidus,A., Lindquist,E., Lucas,S.,
            Padamsee,M., Kumar,T.K.A., Binder,M., Boyd,A., Calvo,A.,
            Furukawa,K., Hesse,C., Hohmann,S., James,T., Miller,K.,
            Shantappa,S., Hibbett,D., McLaughlin,D., Spatafora,J., Aime,M.C.
            and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (22-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_006531963).
            
            ##Metadata-START##
            Organism Display Name :: Wallemia sebi CBS 633.66
            GOLD Stamp ID         :: Gi04865
            Assembly Name         :: Wallemia sebi v1.0
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..684
                     /organism="Wallemia mellicola CBS 633.66"
                     /mol_type="mRNA"
                     /strain="CBS 633.66"
                     /culture_collection="CBS:633.66"
                     /type_material="culture from holotype of Wallemia
                     mellicola"
                     /db_xref="taxon:671144"
                     /chromosome="Unknown"
     gene            1..684
                     /locus_tag="WALSEDRAFT_60048"
                     /db_xref="GeneID:18473708"
     CDS             286..624
                     /locus_tag="WALSEDRAFT_60048"
                     /note="hypothetical protein UM05520.1; expressed protein"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_006957643.1"
                     /db_xref="GeneID:18473708"
                     /db_xref="JGIDB:Walse1_60048"
                     /translation="
MKKIKDELNRKAYLEMVGSSLFPQDEQKRKRKSVYKETKDELQVITSVLFSMVAVATAIWWAGGTMNPTYKTLLAMFGAIAIAIVETALYVIIQMRKSETGRDTEERKKKSQ"
     misc_feature    286..558
                     /locus_tag="WALSEDRAFT_60048"
                     /note="Endoplasmic reticulum-based factor for assembly of
                     V-ATPase; Region: Vma12; pfam11712"
                     /db_xref="CDD:463329"
ORIGIN      
gttgagctcgtggaaaagctaaataatgtagcaagaggaaatggagagtatagagaagttgatgtcagcacactaacacatgaagatattacatatattatcaagtttgtgagaaaacacagtcagacactccaagagaaaggaatagatacacgtcaatatagcgttgtgacgctccttgctggttctactaattcagataacgcaatacaatcgttcaaagtaggtaactggaggatatatgctcaattaacaccagaacagagcacggaatatgatgagaatatgaagaagatcaaagatgagctcaatagaaaggcttatcttgagatggtcggatcttctctatttcctcaagacgagcagaagcgcaagaggaagtctgtatacaaggagacgaaggatgagctacaagtaattacatcggtgttgtttagcatggtagctgtagcaactgctatatggtgggccggtggtacgatgaatccgacatataaaacattactggcgatgtttggtgctatcgcaattgcaatagtagagacagcgctgtatgtcataatacagatgcgcaaaagcgagactgggagggatacagaggagagaaaaaagaaatcacagtagaatgtatgaataaactgttgtatgaatattttatatcgtcaatcgatgatcatctgaccc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]