LOCUS       XM_006838959             525 bp    mRNA    linear   PLN 04-APR-2017
DEFINITION  PREDICTED: Amborella trichopoda F-box/kelch-repeat protein SKIP30
            (LOC18429676), mRNA.
ACCESSION   XM_006838959
VERSION     XM_006838959.1
DBLINK      BioProject: PRJNA238126
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Amborella trichopoda
  ORGANISM  Amborella trichopoda
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Amborellales; Amborellaceae;
            Amborella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006497648.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Amborella trichopoda Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..525
                     /organism="Amborella trichopoda"
                     /mol_type="mRNA"
                     /db_xref="taxon:13333"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /country="USA: California; University of California Santa
                     Cruz Arboretum"
                     /lat_lon="36.983 N 122.060 W"
                     /collection_date="2001"
     gene            1..525
                     /gene="LOC18429676"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:18429676"
     CDS             1..525
                     /gene="LOC18429676"
                     /codon_start=1
                     /product="F-box/kelch-repeat protein SKIP30"
                     /protein_id="XP_006839022.1"
                     /db_xref="GeneID:18429676"
                     /translation="

MCLARVPFSSYPTLCLVSHSWRDAIQSPDLFKMRIEVNSTEDFLCVFAAQRENLWQLYDPSRDIWMSLPPLPTTIHRIRWFCTSSEHPLDPLTGGSEHPLDPLTGEIGPPVVTNEVWCYNPAWRQWAQHSPMRSPRHSFACCAWEGRILIAGGFTTGEVEINAAEVYDPVLDVW"

     misc_feature    <4..102
                     /gene="LOC18429676"
                     /note="F-box domain superfamily; Region: F-box_SF;
                     cl45894"
                     /db_xref="CDD:459239"
     misc_feature    <172..522
                     /gene="LOC18429676"
                     /note="kelch-like protein; Provisional; Region: PHA03098"
                     /db_xref="CDD:222983"
     misc_feature    235..399
                     /gene="LOC18429676"
                     /note="KELCH repeat [structural motif]; Region: KELCH
                     repeat"
                     /db_xref="CDD:276965"
ORIGIN      

atgtgcctggctcgtgtgccattctcttcatacccaaccctttgcctcgtctcccactcatggcgggatgcgatacagagcccagacctcttcaagatgcggatcgaagtaaactccactgaggatttcctatgtgttttcgccgcgcaacgtgaaaacctttggcagctctatgacccctcgagagatatctggatgagcctgcccccactcccaacaactatccatagaattagatggttctgtacctcaagtgaacatcctttggacccactaactgggggaagtgaacatcctttggacccactaactggggaaatcggaccccctgtagtgacgaacgaggtgtggtgttacaacccagcatggcgccagtgggcccagcactcacctatgcgatctccacgtcactcgttcgcttgttgtgcttgggagggccggatactcatcgcagggggcttcactacaggagaggtggagatcaatgcagcagaggtttacgaccccgtgcttgatgtgtggtag

//