GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 15:35:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_006819277            1695 bp    mRNA    linear   INV 18-FEB-2014
DEFINITION  PREDICTED: Saccoglossus kowalevskii uncharacterized LOC102809685
            (LOC102809685), mRNA.
ACCESSION   XM_006819277
VERSION     XM_006819277.1
DBLINK      BioProject: PRJNA42857
KEYWORDS    RefSeq.
SOURCE      Saccoglossus kowalevskii
  ORGANISM  Saccoglossus kowalevskii
            Eukaryota; Metazoa; Hemichordata; Enteropneusta; Harrimaniidae;
            Saccoglossus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003134363.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Saccoglossus kowalevskii Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 5.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1695
                     /organism="Saccoglossus kowalevskii"
                     /mol_type="mRNA"
                     /isolation_source="beach area of Waquoit Pond near Woods
                     Hole, MA"
                     /db_xref="taxon:10224"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="testes"
                     /country="USA: MA"
     gene            1..1695
                     /gene="LOC102809685"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:102809685"
     CDS             1..1695
                     /gene="LOC102809685"
                     /codon_start=1
                     /product="uncharacterized protein LOC102809685"
                     /protein_id="XP_006819340.1"
                     /db_xref="GeneID:102809685"
                     /translation="
MYCSCMDKDNVVAARHKIKLVAWVRAIVARHKVRLVAWVRAIVARHKVRLVAWIRAIVARHNIKLVAWVRAIVARHKVRLVAWVRAIVARHNIKLVAWVRAIVAKHNIKLVAWIRAIVARHKVKLVAIVARHKVKLVAWVRAIVARHKVRAIVARHKVKLVAWVRAIVARHKVKLVAWVRAIAARHKVKLVACVRAIVARHNIKLVAWVRAIVARHKVRLVAWVRAIVAWHKVKLVAWVRAIVAWHKVKLVAWVRAIAARHKVKLVACVRAIVARHKVKLVACVRAIVARHNIKLVAWVRAIAARHNVKLVAWVRAIVARHKVRLVAWVRAIVARHKVKLVAWVRAIVARHKVKLVAWVRAIVARHKVKLVACVRAIVARHKVKLVACVRAIVARHNIKLVAWVRAIAARHNVKLVAWVRAIVARHKVKLVAWVRAIVARHKVKLVAWVRAIVAGHKVKLVACVRAIVARHKVKLVSWVRAIVARHNIKLVAWVRAIFARNNVELVAWVRAIVAWHNVKLVAWVRAIVARHKVRLVAWVRAIVARHKVKLVAWVRAIVARHKVK"
ORIGIN      
atgtactgtagttgcatggataaggacaatgtcgtagctgctagacataaaatcaagttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatggattagggcaatagttgcaaggcataatatcaagttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatgggtaagggcaatagttgcaaggcataatatcaagttagttgcatgggtaagggcaatagttgcaaagcataatatcaagttagttgcatggattagggcaatagttgcaaggcataaagtcaagttagttgcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaagacataaagtcagggcaatagttgcaagacacaaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagttgcatgggtaagggcaattgctgcaaggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataatatcaagttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatgggtaagggcaatagttgcatggcataaagtcaagttagttgcatgggttagagcaatagttgcatggcataaagtcaagttagttgcatgggtaagggcaatagctgcaaggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataaagtcaaattagtagcatgtgtaagggcaatagttgcaagacataatatcaaattagttgcatgggtaagggcaatagctgcaaggcataatgtcaagttagttgcatgggtaagggcaatagttgcaaggcataaagtcaggttagttgcatgggtaagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataaagtcaaattagtagcatgtgtaagggcaatagttgcaagacataatatcaaattagttgcatgggtaagggcaatagctgcaaggcataatgtcaagttagttgcatgggtaagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcagggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataaagtcaagttagtttcatgggtaagggcaatagttgcaaggcataatatcaagttagttgcatgggttagggcaatatttgcaaggaataatgtcgagttagttgcgtgggtaagggcaatagttgcatggcataatgtcaagctagttgcatgggttagggcaatagttgcaaggcataaagtcaggttagttgcatgggtaagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]