2024-05-17 15:35:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006819277 1695 bp mRNA linear INV 18-FEB-2014 DEFINITION PREDICTED: Saccoglossus kowalevskii uncharacterized LOC102809685 (LOC102809685), mRNA. ACCESSION XM_006819277 VERSION XM_006819277.1 DBLINK BioProject: PRJNA42857 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta; Harrimaniidae; Saccoglossus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_003134363.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Saccoglossus kowalevskii Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 5.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1695 /organism="Saccoglossus kowalevskii" /mol_type="mRNA" /isolation_source="beach area of Waquoit Pond near Woods Hole, MA" /db_xref="taxon:10224" /chromosome="Unknown" /sex="male" /tissue_type="testes" /country="USA: MA" gene 1..1695 /gene="LOC102809685" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:102809685" CDS 1..1695 /gene="LOC102809685" /codon_start=1 /product="uncharacterized protein LOC102809685" /protein_id="XP_006819340.1" /db_xref="GeneID:102809685" /translation="
MYCSCMDKDNVVAARHKIKLVAWVRAIVARHKVRLVAWVRAIVARHKVRLVAWIRAIVARHNIKLVAWVRAIVARHKVRLVAWVRAIVARHNIKLVAWVRAIVAKHNIKLVAWIRAIVARHKVKLVAIVARHKVKLVAWVRAIVARHKVRAIVARHKVKLVAWVRAIVARHKVKLVAWVRAIAARHKVKLVACVRAIVARHNIKLVAWVRAIVARHKVRLVAWVRAIVAWHKVKLVAWVRAIVAWHKVKLVAWVRAIAARHKVKLVACVRAIVARHKVKLVACVRAIVARHNIKLVAWVRAIAARHNVKLVAWVRAIVARHKVRLVAWVRAIVARHKVKLVAWVRAIVARHKVKLVAWVRAIVARHKVKLVACVRAIVARHKVKLVACVRAIVARHNIKLVAWVRAIAARHNVKLVAWVRAIVARHKVKLVAWVRAIVARHKVKLVAWVRAIVAGHKVKLVACVRAIVARHKVKLVSWVRAIVARHNIKLVAWVRAIFARNNVELVAWVRAIVAWHNVKLVAWVRAIVARHKVRLVAWVRAIVARHKVKLVAWVRAIVARHKVK"
ORIGIN
atgtactgtagttgcatggataaggacaatgtcgtagctgctagacataaaatcaagttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatggattagggcaatagttgcaaggcataatatcaagttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatgggtaagggcaatagttgcaaggcataatatcaagttagttgcatgggtaagggcaatagttgcaaagcataatatcaagttagttgcatggattagggcaatagttgcaaggcataaagtcaagttagttgcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaagacataaagtcagggcaatagttgcaagacacaaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagttgcatgggtaagggcaattgctgcaaggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataatatcaagttagttgcatgggttagggcaatagttgcaagacataaagtcaggttagttgcatgggtaagggcaatagttgcatggcataaagtcaagttagttgcatgggttagagcaatagttgcatggcataaagtcaagttagttgcatgggtaagggcaatagctgcaaggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataaagtcaaattagtagcatgtgtaagggcaatagttgcaagacataatatcaaattagttgcatgggtaagggcaatagctgcaaggcataatgtcaagttagttgcatgggtaagggcaatagttgcaaggcataaagtcaggttagttgcatgggtaagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataaagtcaaattagtagcatgtgtaagggcaatagttgcaagacataatatcaaattagttgcatgggtaagggcaatagctgcaaggcataatgtcaagttagttgcatgggtaagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcagggcataaagtcaagttagtagcatgtgtaagggcaatagttgcaagacataaagtcaagttagtttcatgggtaagggcaatagttgcaaggcataatatcaagttagttgcatgggttagggcaatatttgcaaggaataatgtcgagttagttgcgtgggtaagggcaatagttgcatggcataatgtcaagctagttgcatgggttagggcaatagttgcaaggcataaagtcaggttagttgcatgggtaagggcaatagttgcaaggcataaagtcaagttagttgcatgggttagggcaatagttgcaaggcataaagtcaagtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]